DI191_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DI191_ARATH
• UniProt AC: Q39083
• Protein Name: Protein DEHYDRATION-INDUCED 19
• Gene Name: DI19-1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 206
• Subcellular Localization: Nucleus .
• Protein Sequence: MDADSKRFLATLRSRSEMLMGFEEIDGDDDFQEEFACPFCAESYDIIGLCCHIDDEHTLESKNAVCPVCSLKVGVDIVAHITLHHGSLFKLQRKRKSRKSGTNSTLSLLRKELREGDLQRLLGFTSRNGSVASSVTPDPLLSSFISPTRSQSSPAPRQTKNVSEDKQIERKRQVFISPVSLKDREERRHKSEFVQRLLSSAIFDEV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
104	Phosphorylation	SRKSGTNSTLSLLRK CCCCCCHHHHHHHHH	30.48	16786289
105	Phosphorylation	RKSGTNSTLSLLRKE CCCCCHHHHHHHHHH	23.57	16438971
107	Phosphorylation	SGTNSTLSLLRKELR CCCHHHHHHHHHHHH	25.99	16438971

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DI191_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DI191_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DI191_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDPKB_ARATH	CDPK2	physical	16438971

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.