| UniProt ID | RBX1A_ARATH | |
|---|---|---|
| UniProt AC | Q940X7 | |
| Protein Name | RING-box protein 1a | |
| Gene Name | RBX1A | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 118 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | Component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. The SCF complex plays a crucial role in regulating response to auxin and is essential for growth and development. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme, to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL1.. | |
| Protein Sequence | MATLDSDVTMIPAGEASSSVAASSSNKKAKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MATLDSDVT ------CCCCCCCCE | 19.50 | 22223895 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RBX1A_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RBX1A_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RBX1A_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CUL4_ARATH | CUL4 | physical | 16844902 | |
| DET1_ARATH | DET1 | physical | 16792691 | |
| CUL1_ARATH | CUL1 | physical | 12215511 | |
| TIR_ARATH | TIR | physical | 12215511 | |
| CUL1_ARATH | CUL1 | physical | 12381738 | |
| CUL4_ARATH | CUL4 | physical | 12381738 | |
| RCE1_ARATH | RCE1 | physical | 12682009 | |
| CUL3A_ARATH | CUL3 | physical | 15618422 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
