RCE1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RCE1_ARATH
• UniProt AC: Q9SDY5
• Protein Name: NEDD8-conjugating enzyme Ubc12
• Gene Name: RCE1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 184
• Protein Description: Accepts the ubiquitin-like protein NEDD8/RUB1 from the ECR1-AXR1 E1 complex and catalyzes its covalent attachment to other proteins..
• Protein Sequence: MIGLFKVKEKQREQAQNATRGGASVKKQSAGELRLHKDISELNLPSSCSISFPNGKDDLMNFEVSIKPDDGYYHNGTFVFTFQVSPVYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTVIYGLFHLFTEPNSEDPLNHDAAAVLRDNPKLFETNVRRAMTGGYVGQTFFPRCI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
29	Phosphorylation	GASVKKQSAGELRLH CHHHHHCCCCCEEEC	47.31	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RCE1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RCE1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RCE1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RBX1A_ARATH	RBX1	physical	12682009
TIR1_ARATH	TIR1	physical	12682009
GRH1_ARATH	GRH1	physical	12682009

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.