dbPTM

FB316_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FB316_ARATH
UniProt AC	Q8GX77
Protein Name	F-box protein At1g61340
Gene Name	At1g61340
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	185
Subcellular Localization
Protein Description
Protein Sequence	MALGKKRIVTQKPNLRQRRDVDNGGLGLGLEFVQYKRGFGRKRILISSGDEMEDSIFTSPVGKKLCDDKTTSVAEGQSRELEDLPLDILVRIICGVEHEDLKQLFHVSKTIREATMIAKQSHFAYSTPRKTSVFHHGRFGWDKPFDVEDDDEEIEAPGAPLQKRYRLSRINRNKDDSGVSVALFH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of FB316_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FB316_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FB316_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FB316_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SKP1A_ARATH	SKP1	physical	21798944
CDC23_ARATH	APC8	physical	21798944
SKP1B_ARATH	ASK2	physical	21798944
HS23M_ARATH	HSP23.6-MITO	physical	21798944
14336_ARATH	GRF6	physical	22920997

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FB316_ARATH

Related Literatures of Post-Translational Modification