dbPTM

HS23M_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HS23M_ARATH
UniProt AC	Q96331
Protein Name	23.6 kDa heat shock protein, mitochondrial
Gene Name	HSP23.6
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	210
Subcellular Localization	Mitochondrion .
Protein Description
Protein Sequence	MASALALKRLLSSSIAPRSRSVLRPAVSSRLFNTNAVRSYDDDGENGDGVDLYRRSVPRRRGDFFSDVFDPFSPTRSVSQVLNLMDQFMENPLLSATRGMGASGARRGWDIKEKDDALYLRIDMPGLSREDVKLALEQDTLVIRGEGKNEEDGGEEGESGNRRFTSRIGLPDKIYKIDEIKAEMKNGVLKVVIPKMKEQERNDVRQIEIN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of HS23M_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HS23M_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HS23M_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HS23M_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HS23M_ARATH	HSP23.6-MITO	physical	21798944
GRXC5_ARATH	AT4G28730	physical	21798944
ALF4_ARATH	ALF4	physical	21798944
NDUB9_ARATH	AT4G34700	physical	21798944
PNSL5_ARATH	CYP20-2	physical	21798944
FKB12_ARATH	FKBP12	physical	21798944
SA1B1_ARATH	SAE1B	physical	21798944
SA1B2_ARATH	SAE1B	physical	21798944
HS181_ARATH	HSP18.2	physical	21798944
TIG_ARATH	AT5G55220	physical	21798944
PS13A_ARATH	AT5G45620	physical	21798944
EDR4_ARATH	AT5G05190	physical	21798944
HS235_ARATH	AT5G51440	physical	21798944
SIM_ARATH	SIM	physical	21798944
CDPKQ_ARATH	CPK26	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HS23M_ARATH

Related Literatures of Post-Translational Modification