UniProt ID | GRXC5_ARATH | |
---|---|---|
UniProt AC | Q8GWS0 | |
Protein Name | Glutaredoxin-C5, chloroplastic {ECO:0000303|PubMed:15170506} | |
Gene Name | GRXC5 {ECO:0000303|PubMed:15170506} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 174 | |
Subcellular Localization | Plastid, chloroplast . | |
Protein Description | Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins. Can assemble a [2Fe-2S] cluster, but cannot transfer it to an apoferredoxin.. | |
Protein Sequence | MAVTAFNTLKLVSSSLDPIPSVSCSSYSFSLIYVGSPYKRCLKQSCSVRAMTSSSSAASSSSSSFGSRMEESIRKTVTENTVVIYSKTWCSYCTEVKTLFKRLGVQPLVVELDQLGPQGPQLQKVLERLTGQHTVPNVFVCGKHIGGCTDTVKLNRKGDLELMLAEANGKNGQS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Acetylation | SCSVRAMTSSSSAAS CCEEEEECCCCCCCC | 25.19 | 22223895 | |
90 | Glutathionylation | VIYSKTWCSYCTEVK EEEECCCHHHHHHHH | 2.22 | 21632542 | |
148 | Glutathionylation | CGKHIGGCTDTVKLN CCEECCCCCCCEEEC | 2.34 | 21632542 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GRXC5_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GRXC5_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRXC5_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SUFE1_ARATH | CPSUFE | physical | 24203231 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...