UniProt ID | SIM_ARATH | |
---|---|---|
UniProt AC | Q9LZ78 | |
Protein Name | Cyclin-dependent protein kinase inhibitor SIM {ECO:0000303|PubMed:24399300, ECO:0000303|PubMed:26546445} | |
Gene Name | SIM {ECO:0000303|PubMed:24399300, ECO:0000303|PubMed:26546445} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 127 | |
Subcellular Localization | Nucleus . | |
Protein Description | Cyclin-dependent protein kinase (CDK) inhibitor that functions as a repressor of mitosis in the endoreduplication cell cycle. [PubMed: 10952891] | |
Protein Sequence | MDLDLIQDLPILNFPPAIKIRANTNRDDDGGGCTTPTSSDHKIPPTTATTPPPPPQKPRPPSTPSSLGIRSCKRKLMTSLSKYEIIVNKDEIERFFSSVYNQTMASSTTTAITVAKRRRSFRSCSRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SIM_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIM_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIM_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIM_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CKB11_ARATH | CDKB1;1 | physical | 20706207 | |
CKS2_ARATH | CKS2 | physical | 20706207 | |
CFIS2_ARATH | AT4G25550 | physical | 20706207 | |
LONM1_ARATH | LON1 | physical | 20706207 | |
PPR87_ARATH | PPR336 | physical | 20706207 | |
CPR5_ARATH | CPR5 | physical | 25455564 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...