SIM_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SIM_ARATH
• UniProt AC: Q9LZ78
• Protein Name: Cyclin-dependent protein kinase inhibitor SIM {ECO:0000303|PubMed:24399300, ECO:0000303|PubMed:26546445}
• Gene Name: SIM {ECO:0000303|PubMed:24399300, ECO:0000303|PubMed:26546445}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 127
• Subcellular Localization: Nucleus .
• Protein Description: Cyclin-dependent protein kinase (CDK) inhibitor that functions as a repressor of mitosis in the endoreduplication cell cycle. [PubMed: 10952891]
• Protein Sequence: MDLDLIQDLPILNFPPAIKIRANTNRDDDGGGCTTPTSSDHKIPPTTATTPPPPPQKPRPPSTPSSLGIRSCKRKLMTSLSKYEIIVNKDEIERFFSSVYNQTMASSTTTAITVAKRRRSFRSCSRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SIM_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SIM_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SIM_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SIM_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CKB11_ARATH	CDKB1;1	physical	20706207
CKS2_ARATH	CKS2	physical	20706207
CFIS2_ARATH	AT4G25550	physical	20706207
LONM1_ARATH	LON1	physical	20706207
PPR87_ARATH	PPR336	physical	20706207
CPR5_ARATH	CPR5	physical	25455564

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.