| UniProt ID | CKS2_ARATH | |
|---|---|---|
| UniProt AC | Q9SJJ5 | |
| Protein Name | Cyclin-dependent kinases regulatory subunit 2 | |
| Gene Name | CKS2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 83 | |
| Subcellular Localization | ||
| Protein Description | Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.. | |
| Protein Sequence | MGQIQYSDKYFDDTFEYRHVVLPPEVAKLLPKNRILSESEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQEHQAQIAK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of CKS2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CKS2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CKS2_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CKS2_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CCA34_ARATH | CYCA3;4 | physical | 20407024 | |
| CCD21_ARATH | CYCD2;1 | physical | 20407024 | |
| CCD41_ARATH | CYCD4;1 | physical | 20407024 | |
| CCD42_ARATH | CYCD4;2 | physical | 20407024 | |
| CCD51_ARATH | CYCD5;1 | physical | 20407024 | |
| CCD61_ARATH | CYCD6;1 | physical | 20407024 | |
| CCH11_ARATH | CYCH;1 | physical | 20407024 | |
| E2FE_ARATH | DEL1 | physical | 20407024 | |
| KRP1_ARATH | ICK1 | physical | 20407024 | |
| KRP2_ARATH | KRP2 | physical | 20407024 | |
| KRP3_ARATH | ICK6 | physical | 20407024 | |
| KRP4_ARATH | KRP4 | physical | 20407024 | |
| KRP5_ARATH | ICK3 | physical | 20407024 | |
| KRP6_ARATH | KRP6 | physical | 20407024 | |
| KRP7_ARATH | ICK5 | physical | 20407024 | |
| FZR3_ARATH | FZR3 | physical | 20407024 | |
| CKB11_ARATH | CDKB1;1 | physical | 20706207 | |
| RH9_ARATH | PMH1 | physical | 20706207 | |
| BH129_ARATH | AT2G43140 | physical | 20706207 | |
| BH128_ARATH | AT1G05805 | physical | 20706207 | |
| GLDH_ARATH | GLDH | physical | 20706207 | |
| SNF12_ARATH | CHC1 | physical | 20706207 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
