UniProt ID | FZR3_ARATH | |
---|---|---|
UniProt AC | Q8LPL5 | |
Protein Name | Protein FIZZY-RELATED 3 | |
Gene Name | FZR3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 481 | |
Subcellular Localization | ||
Protein Description | Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).. | |
Protein Sequence | MASPQSTKTGLNLPAGMNQTSLRLETFSSSFRGISSLSSPSKSTCSDRFIPCRSSSRLHAFDLQDKEPTTPVKEGGNEAYSRLLKSELFGSDFASPLLSPAGGQGSASSPMSPCTNMLRFKTDRSNSSPSSPFSPSILGNDNGHSSDSSPPPKPPRKVPKTPHKVLDAPSLQDDFYLNVVDWSSQNVLAVGLGTCVYLWTASNSKVTKLCDLGPNDSVCSVQWTREGSYISIGTSHGQVQVWDGTQCKRVRTMGGHQTRTGVLAWNSRILSSGSRDRNILQHDIRVQSDFVSKLVGHKSEVCGLKWSHDDRELASGGNDNQLLVWNNHSQQPILKLTEHTAAVKAITWSPHQSSLLASGGGTADRCIRFWNTTNGNQLNSIDTGSQVCNLAWSKNVNEIVSTHGYSQNQIMLWKYPSMSKVATLTGHSMRVLYLATSPDGQTIVTGAGDETLRFWNVFPSVKMQTPVKDTGLWSLGRTQIR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FZR3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FZR3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FZR3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
APC4_SCHPO | cut20 | physical | 15970679 | |
CDKA1_ARATH | CDC2 | physical | 15970679 | |
CCB23_ARATH | CYCB2;3 | physical | 20407024 | |
APC2_ARATH | APC2 | physical | 20706207 | |
CDC23_ARATH | APC8 | physical | 20706207 | |
CKS2_ARATH | CKS2 | physical | 20706207 | |
PYM_ARATH | UVI4 | physical | 20706207 | |
GIG1_ARATH | UVI4-LIKE | physical | 20706207 | |
CD27B_ARATH | HBT | physical | 20706207 | |
APC1_ARATH | EMB2771 | physical | 20706207 | |
APC4_ARATH | AT4G21530 | physical | 20706207 | |
APC5_ARATH | AT1G06590 | physical | 20706207 | |
APC7_ARATH | AT2G39090 | physical | 20706207 | |
CDC16_ARATH | APC6 | physical | 20706207 | |
CKS1_ARATH | CKS1 | physical | 20706207 | |
SKIP_ARATH | SKIP | physical | 20706207 | |
IF2B_ARATH | EIF2 BETA | physical | 20706207 | |
PGMC1_ARATH | AT1G23190 | physical | 20706207 | |
THO4B_ARATH | AT5G02530 | physical | 20706207 | |
TCPA_ARATH | TCP-1 | physical | 20706207 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...