UniProt ID | THO4B_ARATH | |
---|---|---|
UniProt AC | Q8L719 | |
Protein Name | THO complex subunit 4B | |
Gene Name | ALY2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 292 | |
Subcellular Localization | Nucleus, nucleoplasm . | |
Protein Description | Export adapter involved in nuclear export of spliced and unspliced mRNA.. | |
Protein Sequence | MSGGLDMSLDDIIKSNRKPTGSRGRGGIGGGNNTGGRGGSGSNSGPSRRFANRVGARTAPYSRPIQQQQAHDAMWQNDVFATDASVAAAFGHHQTAVVGGGSSIETGTKLYISNLDYGVSNEDIKELFSEVGDLKRYGIHYDRSGRSKGTAEVVFSRRGDALAAVKRYNNVQLDGKLMKIEIVGTNLSAPALPILATAQIPFPTNGILGNFNENFNGNFNGNFNGNFRGRGRGGFMGRPRGGGFGGGNFRGGRGARGRGGRGSGGRGRDENVSAEDLDAELDKYHKEAMETS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSGGLDMSL ------CCCCCCCCH | 22223895 | ||
2 | Phosphorylation | ------MSGGLDMSL ------CCCCCCCCH | 19880383 | ||
8 | Phosphorylation | MSGGLDMSLDDIIKS CCCCCCCCHHHHHHC | 19880383 | ||
273 | Phosphorylation | RGRDENVSAEDLDAE CCCCCCCCHHHHHHH | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THO4B_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THO4B_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THO4B_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FZR1_ARATH | CCS52A2 | physical | 20706207 | |
THO4B_ARATH | AT5G02530 | physical | 21798944 | |
THO4B_ARATH | AT5G02530 | physical | 19435936 | |
THO4C_ARATH | AT1G66260 | physical | 19435936 | |
IF4A1_ARATH | EIF4A1 | physical | 19435936 | |
THO4D_ARATH | ALY4 | physical | 19435936 | |
MGN_ARATH | MAGO | physical | 19435936 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...