UniProt ID | THO4C_ARATH | |
---|---|---|
UniProt AC | Q94EH8 | |
Protein Name | THO complex subunit 4C | |
Gene Name | ALY3 {ECO:0000303|PubMed:15299117} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 295 | |
Subcellular Localization | Nucleus, nucleoplasm . Nucleus, nucleolus . | |
Protein Description | Export adapter involved in nuclear export of spliced and unspliced mRNA.. | |
Protein Sequence | MSDALNMTLDEIVKKSKSERSAAARSGGKGVSRKSGRGRGGPNGVVGGGRGGGPVRRGPLAVNTRPSSSFSINKLARRKRSLPWQNQNDLYEETLRAVGVSGVEVGTTVYITNLDQGVTNEDIRELYAEIGELKRYAIHYDKNGRPSGSAEVVYMRRSDAIQAMRKYNNVLLDGRPMKLEILGGNTESAPVAARVNVTGLNGRMKRSVFIGQGVRGGRVGRGRGSGPSGRRLPLQQNQQGGVTAGRGGFRGRGRGNGGGRGNKSGGRGGKKPVEKSAADLDKDLESYHAEAMNIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSDALNMTL ------CCHHHHCCH | - | ||
8 | Phosphorylation | MSDALNMTLDEIVKK CCHHHHCCHHHHHHH | 19880383 | ||
67 | Phosphorylation | LAVNTRPSSSFSINK EECCCCCCCCCCHHH | 25561503 | ||
68 | Phosphorylation | AVNTRPSSSFSINKL ECCCCCCCCCCHHHH | 25561503 | ||
69 | Phosphorylation | VNTRPSSSFSINKLA CCCCCCCCCCHHHHH | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THO4C_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THO4C_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THO4C_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of THO4C_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...