UniProt ID | IF4A1_ARATH | |
---|---|---|
UniProt AC | P41376 | |
Protein Name | Eukaryotic initiation factor 4A-1 | |
Gene Name | TIF4A-1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 412 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.. | |
Protein Sequence | MAGSAPEGTQFDARQFDQKLNEVLEGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLRADNIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAGSAPEGT ------CCCCCCCCC | 22.20 | 22223895 | |
4 | Phosphorylation | ----MAGSAPEGTQF ----CCCCCCCCCCC | 30.98 | 27531888 | |
9 | Phosphorylation | AGSAPEGTQFDARQF CCCCCCCCCCCHHHH | 25.13 | 27288362 | |
85 | Phosphorylation | DVIQQAQSGTGKTAT HHHHHHHCCCCHHHH | 41.14 | 19880383 | |
87 | Phosphorylation | IQQAQSGTGKTATFC HHHHHCCCCHHHHHC | 40.53 | 23111157 | |
104 | Phosphorylation | VLQQLDFSLIQCQAL HHHHCCCCHHHHCHH | 24.99 | - | |
145 | Phosphorylation | VHACVGGTSVREDQR EEEECCCCCHHHHHH | 20.37 | 30291188 | |
146 | Phosphorylation | HACVGGTSVREDQRI EEECCCCCHHHHHHH | 23.58 | 27532006 | |
256 | Phosphorylation | LEGIKQFYVNVEKEE HHHHHHEEEEECCHH | 6.66 | 24894044 | |
334 | Phosphorylation | GSSRVLITTDLLARG CCCEEEEEHHHHHCC | 15.31 | 19880383 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IF4A1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IF4A1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDKA1_ARATH | CDC2 | physical | 14706832 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...