IF4A1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IF4A1_ARATH
• UniProt AC: P41376
• Protein Name: Eukaryotic initiation factor 4A-1
• Gene Name: TIF4A-1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 412
• Subcellular Localization: Cytoplasm.
• Protein Description: ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon..
• Protein Sequence: MAGSAPEGTQFDARQFDQKLNEVLEGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLRADNIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAGSAPEGT ------CCCCCCCCC	22.20	22223895
4	Phosphorylation	----MAGSAPEGTQF ----CCCCCCCCCCC	30.98	27531888
9	Phosphorylation	AGSAPEGTQFDARQF CCCCCCCCCCCHHHH	25.13	27288362
85	Phosphorylation	DVIQQAQSGTGKTAT HHHHHHHCCCCHHHH	41.14	19880383
87	Phosphorylation	IQQAQSGTGKTATFC HHHHHCCCCHHHHHC	40.53	23111157
104	Phosphorylation	VLQQLDFSLIQCQAL HHHHCCCCHHHHCHH	24.99	-
145	Phosphorylation	VHACVGGTSVREDQR EEEECCCCCHHHHHH	20.37	30291188
146	Phosphorylation	HACVGGTSVREDQRI EEECCCCCHHHHHHH	23.58	27532006
256	Phosphorylation	LEGIKQFYVNVEKEE HHHHHHEEEEECCHH	6.66	24894044
334	Phosphorylation	GSSRVLITTDLLARG CCCEEEEEHHHHHCC	15.31	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	TaMAB2	-	PMID:31824527

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IF4A1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IF4A1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDKA1_ARATH	CDC2	physical	14706832

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.