dbPTM

CKS1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CKS1_ARATH
UniProt AC	O23249
Protein Name	Cyclin-dependent kinases regulatory subunit 1
Gene Name	CKS1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	87
Subcellular Localization
Protein Description	Associates with cyclin-dependent kinases (CDKs) and plays an essential role in the regulation of the cell cycle that affects plant growth rate. May inhibit both the G1/S and G2/M phases..
Protein Sequence	MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQENQAQNMLVK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
84	Sulfoxidation	QENQAQNMLVK---- HHHHHHHHCCC----	2.79	23289948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CKS1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CKS1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CKS1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CKB11_ARATH	CDKB1;1	physical	17426018
CCD21_ARATH	CYCD2;1	physical	17426018
AKRCB_ARATH	AT3G53880	physical	17426018
CKB21_ARATH	CDKB2;1	physical	17426018
CDKA1_ARATH	CDC2	physical	9276444
CKB11_ARATH	CDKB1;1	physical	9276444
CCA34_ARATH	CYCA3;4	physical	20407024
CCD33_ARATH	CYCD3;3	physical	20407024
CCD41_ARATH	CYCD4;1	physical	20407024
CCD42_ARATH	CYCD4;2	physical	20407024
CCD51_ARATH	CYCD5;1	physical	20407024
CCD61_ARATH	CYCD6;1	physical	20407024
CCH11_ARATH	CYCH;1	physical	20407024
E2FE_ARATH	DEL1	physical	20407024
KRP1_ARATH	ICK1	physical	20407024
KRP2_ARATH	KRP2	physical	20407024
KRP3_ARATH	ICK6	physical	20407024
KRP4_ARATH	KRP4	physical	20407024
KRP6_ARATH	KRP6	physical	20407024
FZR3_ARATH	FZR3	physical	20407024
CDKA1_ARATH	CDC2	physical	20706207
CKB11_ARATH	CDKB1;1	physical	20706207
CKB21_ARATH	CDKB2;1	physical	20706207
CKB22_ARATH	CDKB2;2	physical	20706207
CCA34_ARATH	CYCA3;4	physical	20706207
CCD21_ARATH	CYCD2;1	physical	20706207
ARAK_ARATH	ARA1	physical	20706207
KRP6_ARATH	KRP6	physical	20706207
AKRCB_ARATH	AT3G53880	physical	20706207
P5CS1_ARATH	P5CS1	physical	20706207
P5CS2_ARATH	P5CS2	physical	20706207
Y2186_ARATH	AT2G31862	physical	20706207
Y5815_ARATH	AT5G58150	physical	20706207
LONM1_ARATH	LON1	physical	20706207

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CKS1_ARATH

Related Literatures of Post-Translational Modification