UniProt ID | CCH11_ARATH | |
---|---|---|
UniProt AC | Q8W5S1 | |
Protein Name | Cyclin-H1-1 | |
Gene Name | CYCH1-1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 336 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Associates with CDK-2 and CDK-3 and activates the CDK kinases.. | |
Protein Sequence | MADFQTSTQRAKWIFTPQKLAERYKAANQRAVQMLEKCGTTQVEVDASGSLTYPKDKVGSGDQADKKLKPLSADEERFMRAFYEAKVQEVCSAFAFPHKIQATALQYFKRFYLQWSVMQHHPKEIMLTCVYAACKIEENHVSAEEIGKGINQDHRIILKYEMAVLQSLEFDLIVYAPYRAIEGFVNNMEEFLQARDDEIQKLESLLKGATAEADKVMLTDAPLLFPPGQLALASLRIANGVLGVIDFDRYLENIVSQPNSEHTTSELTKLLDNIEYLVKNYKCPSEKDMKHINRKLKSCLGHSSSHDESKKREKRSKHKSHRSSNDTPNGAPPPIG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADFQTSTQ ------CCCCCCCCC | 26.73 | 22223895 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCH11_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCH11_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCH11_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDKD3_ARATH | CDKD1;3 | physical | 15486101 | |
CDKD1_ARATH | CDKD1;1 | physical | 15486101 | |
CDKD2_ARATH | CAK4 | physical | 15486101 | |
CDKF1_ARATH | CAK1AT | physical | 20407024 | |
CDKC1_ARATH | CDKC;1 | physical | 20706207 | |
CDKC2_ARATH | CDKC2 | physical | 20706207 | |
BAS1A_ARATH | AT3G11630 | physical | 20706207 | |
RPB9A_ARATH | NRPB9A | physical | 20706207 | |
MTNA_ARATH | AT2G05830 | physical | 20706207 | |
RBG2_ARATH | GR-RBP2 | physical | 20706207 | |
MDHC1_ARATH | AT1G04410 | physical | 20706207 | |
NDK1_ARATH | NDPK1 | physical | 20706207 | |
PUR5_ARATH | PUR5 | physical | 20706207 | |
PABP4_ARATH | PAB4 | physical | 20706207 | |
POP3_ARATH | HS1 | physical | 20706207 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...