UniProt ID | CDKD2_ARATH | |
---|---|---|
UniProt AC | Q9C9M7 | |
Protein Name | Cyclin-dependent kinase D-2 | |
Gene Name | CDKD-2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 348 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Forms a stable complex with cyclin CYCH1-1 that phosphorylates human CDK2 and the C-terminal domain (CTD) of the large subunit of RNA polymerase II.. | |
Protein Sequence | MSKSGDNQPVDRYLRRQILGEGTYGVVYKATDTKTGKTVAVKKIRLGNQKEGVNFTALREIKLLKELNHPHIVELIDAFPHDGSLHLVFEYMQTDLEAVIRDRNIFLSPGDIKSYMLMTLKGLAYCHKKWVLHRDMKPNNLLIGENGLLKLADFGLARLFGSPNRRFTHQVFATWYRAPELLFGSRQYGAGVDVWAAGCIFAELLLRRPFLPGSTEIDQLGKIFQAFGTPVPSQWSDMIYLPDYMEFSYTPAPPLRTIFPMASDDALDLLAKMFIYDPRQRITIQQALDHRYFSSSPSPTEPGKLQIPASKGDALEPKASEQNQHGNSPAVLSPPGKMRRVMGPEGFT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Phosphorylation | QILGEGTYGVVYKAT HHHCCCCEEEEEEEE | 20.84 | 16856985 | |
162 | Phosphorylation | GLARLFGSPNRRFTH HHHHHHCCCCCCHHC | 16.21 | 23776212 | |
168 | Phosphorylation | GSPNRRFTHQVFATW CCCCCCHHCHHHHHH | 15.02 | 16856985 | |
320 | Phosphorylation | DALEPKASEQNQHGN CCCCCCHHHCCCCCC | 45.93 | 23776212 | |
328 | Phosphorylation | EQNQHGNSPAVLSPP HCCCCCCCCCCCCCC | 20.87 | 30291188 | |
333 | Phosphorylation | GNSPAVLSPPGKMRR CCCCCCCCCCCCCCC | 23.58 | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
162 | S | Phosphorylation | Kinase | CDK7 | - | GPS |
162 | S | Phosphorylation | Kinase | CAK | - | Uniprot |
168 | T | Phosphorylation | Kinase | CDK7 | - | GPS |
168 | T | Phosphorylation | Kinase | CAK | - | Uniprot |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDKD2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"The plant-specific kinase CDKF;1 is involved in activatingphosphorylation of cyclin-dependent kinase-activating kinases inArabidopsis."; Shimotohno A., Umeda-Hara C., Bisova K., Uchimiya H., Umeda M.; Plant Cell 16:2954-2966(2004). Cited for: FUNCTION, ENZYME REGULATION, SUBCELLULAR LOCATION, INTERACTION WITHCYCH1-1, PHOSPHORYLATION AT SER-162 AND THR-168, AND MUTAGENESIS OFLYS-42; SER-162 AND THR-168. |