CCD41_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCD41_ARATH
• UniProt AC: Q8LGA1
• Protein Name: Cyclin-D4-1
• Gene Name: CYCD4-1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 308
• Protein Description: May activate cell cycle in the root apical meristem (RAM) and promote embryonic root (radicle) protrusion..
• Protein Sequence: MAEENLELSLLCTESNVDDEGMIVDETPIEISIPQMGFSQSESEEIIMEMVEKEKQHLPSDDYIKRLRSGDLDLNVGRRDALNWIWKACEVHQFGPLCFCLAMNYLDRFLSVHDLPSGKGWILQLLAVACLSLAAKIEETEVPMLIDLQVGDPQFVFEAKSVQRMELLVLNKLKWRLRAITPCSYIRYFLRKMSKCDQEPSNTLISRSLQVIASTTKGIDFLEFRPSEVAAAVALSVSGELQRVHFDNSSFSPLFSLLQKERVKKIGEMIESDGSDLCSQTPNGVLEVSACCFSFKTHDSSSSYTHLS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
208	Phosphorylation	SNTLISRSLQVIAST CCCHHHHHHHHHHHC	19.16	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCD41_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCD41_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCD41_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CKS2_ARATH	CKS2	physical	20706207
CKB11_ARATH	CDKB1;1	physical	20706207

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.