| UniProt ID | CKB11_ARATH | |
|---|---|---|
| UniProt AC | P25859 | |
| Protein Name | Cyclin-dependent kinase B1-1 | |
| Gene Name | CDKB1-1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 309 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May control G2/M (mitosis) phase progression. Plays a role in regulating seedling growth in darkness via regulation of hypocotyl cell elongation and cotyledon cell development. Plays a role in stomatal development. Required to suppress endoreduplication. Together with CDKB1-2, promotes both the last division in the stomatal cell lineage as well as the number of stomata. [PubMed: 20675570 In collaboration with MYB124 and MYB88, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage] | |
| Protein Sequence | MEKYEKLEKVGEGTYGKVYKAMEKGTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSTSIYVVRLLCVEHVHQPSTKSQSTKSNLYLVFEYLDTDLKKFIDSYRKGPNPKPLEPFLIQKLMFQLCKGVAHCHSHGVLHRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLKSYTHEIVTLWYRAPEVLLGSTHYSTGVDMWSVGCIFAEMVRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVSTLRDWHVYPKWEPQDLTLAVPSLSPQGVDLLTKMLKYNPAERISAKTALDHPYFDSLDKSQF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Phosphorylation | EKVGEGTYGKVYKAM HCCCCCCHHHHHHHH | 26.30 | - | |
| 176 | Phosphorylation | TVPLKSYTHEIVTLW EEECHHCCCEEEEEE | 21.81 | - | |
| 239 | Phosphorylation | FRLLGTPTEQQWPGV HHHHCCCCHHCCCCC | 46.38 | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 176 | T | Phosphorylation | Kinase | CAK | - | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CKB11_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CKB11_ARATH !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
