UniProt ID | CKB11_ARATH | |
---|---|---|
UniProt AC | P25859 | |
Protein Name | Cyclin-dependent kinase B1-1 | |
Gene Name | CDKB1-1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 309 | |
Subcellular Localization | Nucleus . | |
Protein Description | May control G2/M (mitosis) phase progression. Plays a role in regulating seedling growth in darkness via regulation of hypocotyl cell elongation and cotyledon cell development. Plays a role in stomatal development. Required to suppress endoreduplication. Together with CDKB1-2, promotes both the last division in the stomatal cell lineage as well as the number of stomata. [PubMed: 20675570 In collaboration with MYB124 and MYB88, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage] | |
Protein Sequence | MEKYEKLEKVGEGTYGKVYKAMEKGTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSTSIYVVRLLCVEHVHQPSTKSQSTKSNLYLVFEYLDTDLKKFIDSYRKGPNPKPLEPFLIQKLMFQLCKGVAHCHSHGVLHRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLKSYTHEIVTLWYRAPEVLLGSTHYSTGVDMWSVGCIFAEMVRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVSTLRDWHVYPKWEPQDLTLAVPSLSPQGVDLLTKMLKYNPAERISAKTALDHPYFDSLDKSQF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | EKVGEGTYGKVYKAM HCCCCCCHHHHHHHH | 26.30 | - | |
176 | Phosphorylation | TVPLKSYTHEIVTLW EEECHHCCCEEEEEE | 21.81 | - | |
239 | Phosphorylation | FRLLGTPTEQQWPGV HHHHCCCCHHCCCCC | 46.38 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
176 | T | Phosphorylation | Kinase | CAK | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CKB11_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CKB11_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...