CCA21_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCA21_ARATH
• UniProt AC: Q39071
• Protein Name: Cyclin-A2-1
• Gene Name: CYCA2-1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 443
• Protein Description: May negatively regulate endocycles and act as a regulator of ploidy levels in endoreduplication..
• Protein Sequence: MHRASSKHTNAKKEAISTSKIRDNNVRVTRSRAKALGVSNSPSKPAFKHETKRVARPSNKRMASDNITVCNQKRRAVLKDVTNTLAESIISTEGNVKACKRGGKETKQIEEDGLVDVDGEKSKLAEDLSKIRMVESLDASASKQKLVDCAEEDRSDVTDCVQIVDIDSGVQDPQFCSLYAASIYDSINVAELEQRPSTSYMVQVQRDIDPTMRGILIDWLVEVSEEYKLVSDTLYLTVNLIDRFMSHNYIEKQKLQLLGITCMLIASKYEEISAPRLEEFCFITDNTYTRLEVLSMEIKVLNSLHFRLSVPTTKTFLRRFIRAAQASDKVPLIEMEYLANYFAELTLTEYTFLRFLPSLIAASAVFLARWTLDQSNHPWNQTLQHYTRYETSALKNTVLAMEELQLNTSGSTLIAIHTKYNQQKFKRVATLTSPERVNTLFSR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CCA21_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCA21_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCA21_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCA21_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CKB12_ARATH	CDKB1;2	physical	20407024
CKB11_ARATH	CDKB1;1	physical	20706207
GENL1_ARATH	AT1G01880	physical	20706207
PRS8A_ARATH	RPT6A	physical	20706207
PSMD6_ARATH	AT4G24820	physical	20706207
IF2B_ARATH	EIF2 BETA	physical	20706207

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.