| UniProt ID | CKB12_ARATH | |
|---|---|---|
| UniProt AC | Q2V419 | |
| Protein Name | Cyclin-dependent kinase B1-2 | |
| Gene Name | CDKB1-2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 311 | |
| Subcellular Localization | ||
| Protein Description | Together with CDKB1-1, promotes both the last division in the stomatal cell lineage as well as the number of stomata. [PubMed: 20675570 In collaboration with MYB124 and MYB88, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage] | |
| Protein Sequence | MEKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQSIYIVRLLCVEHVIQSKDSTVSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASLVQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGSTHYSTAVDIWSVGCIFAEMIRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVMALRDWHVYPKWEPQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDHPYFDSLDKSQF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Phosphorylation | EKVGEGTYGKVYKAM HCCCCCCHHHHHHHH | 26.30 | - | |
| 53 | Phosphorylation | PTALREISLLQMLSQ HHHHHHHHHHHHHHC | 20.48 | 24894044 | |
| 63 | Phosphorylation | QMLSQSIYIVRLLCV HHHHCHHHHHHHHHH | 9.90 | 24894044 | |
| 178 | Phosphorylation | TVPLKAYTHEIVTLW CCCCHHHCCCEEEHE | 20.21 | - | |
| 241 | Phosphorylation | FRLLGTPTEQQWPGV HHHHCCCCHHCCCCE | 46.38 | 24243849 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CKB12_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CKB12_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CKB12_ARATH !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
