| UniProt ID | E2FA_ARATH | |
|---|---|---|
| UniProt AC | Q9FNY0 | |
| Protein Name | Transcription factor E2FA | |
| Gene Name | E2FA | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 485 | |
| Subcellular Localization | Cytoplasm . Nucleus . Interaction with DPA induces an exclusive nuclear localization, but an interaction with DPB has no effect. | |
| Protein Description | Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The binding of retinoblastoma-related proteins represses transactivation. Regulates gene expression both positively and negatively. Activates the expression of E2FB. Involved in the control of cell-cycle progression from G1 to S phase. Stimulates cell proliferation and delays differentiation.. | |
| Protein Sequence | MSGVVRSSPGSSQPPPPPPHHPPSSPVPVTSTPVIPPIRRHLAFASTKPPFHPSDDYHRFNPSSLSNNNDRSFVHGCGVVDREEDAVVVRSPSRKRKATMDMVVAPSNNGFTSSGFTNIPSSPCQTPRKGGRVNIKSKAKGNKSTPQTPISTNAGSPITLTPSGSCRYDSSLGLLTKKFVNLIKQAKDGMLDLNKAAETLEVQKRRIYDITNVLEGIDLIEKPFKNRILWKGVDACPGDEDADVSVLQLQAEIENLALEEQALDNQIRQTEERLRDLSENEKNQKWLFVTEEDIKSLPGFQNQTLIAVKAPHGTTLEVPDPDEAADHPQRRYRIILRSTMGPIDVYLVSEFEGKFEDTNGSGAAPPACLPIASSSGSTGHHDIEALTVDNPETAIVSHDHPHPQPGDTSDLNYLQEQVGGMLKITPSDVENDESDYWLLSNAEISMTDIWKTDSGIDWDYGIADVSTPPPGMGEIAPTAVDSTPR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 168 | Phosphorylation | TPSGSCRYDSSLGLL CCCCCCCCCCCCCHH | 25.22 | 23328941 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of E2FA_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of E2FA_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of E2FA_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DPA_ARATH | DPA | physical | 20407024 | |
| DPB_ARATH | DPB | physical | 20407024 | |
| DPB_ARATH | DPB | physical | 20706207 | |
| RBR1_ARATH | RBR1 | physical | 20706207 | |
| DPA_ARATH | DPA | physical | 20706207 | |
| AB2E_ARATH | RLI2 | physical | 20706207 | |
| PS10B_ARATH | AT1G45000 | physical | 20706207 | |
| PSMD6_ARATH | AT4G24820 | physical | 20706207 | |
| ACC1_ARATH | ACC1 | physical | 20706207 | |
| IMPA1_ARATH | IMPA-1 | physical | 20706207 | |
| DPA_ARATH | DPA | physical | 11108847 | |
| DPB_ARATH | DPB | physical | 11108847 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
