CCA31_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCA31_ARATH
• UniProt AC: Q9FMH5
• Protein Name: Putative cyclin-A3-1
• Gene Name: CYCA3-1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 355
• Protein Sequence: MADEKENCVRMTRAATKRKASMEAAIDKERINKKRVVLGELPNLSNIKKSRKATTKQKKKSVSIPTIETLNSDIDTRSDDPQMCGPYVTSIFEYLRQLEVKSRPLVDYIEKIQKDVTSNMRGVLVDWLVEVAEEYKLLSDTLYLAVSYIDRFLSLKTVNKQRLQLLGVTSMLIASKYEEITPPNVDDFCYITDNTYTKQEIVKMEADILLALQFELGNPTSNTFLRRFTRVAQEDFEMSHLQMEFLCSYLSELSMLDYQSVKFLPSTVAASAVFLARFIIRPKQHPWNVMLEEYTRYKAGDLKECVAMIHDLYLSRKCGALEAIREKYKQHKFKCVATMPVSPELPLTVFEDVNI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CCA31_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCA31_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCA31_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCA31_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MLP28_ARATH	MLP28	physical	20706207
CDKA1_ARATH	CDC2	physical	20706207
CKS2_ARATH	CKS2	physical	20706207
RH28_ARATH	AT4G16630	physical	20706207
ELP3_ARATH	ELO3	physical	20706207
IF2B_ARATH	EIF2 BETA	physical	20706207
MTNA_ARATH	AT2G05830	physical	20706207
PAP1_ARATH	FIB	physical	20706207
PPR82_ARATH	AT1G55890	physical	20706207
UBA2A_ARATH	UBA2A	physical	20706207

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.