UniProt ID | MLP28_ARATH | |
---|---|---|
UniProt AC | Q9SSK9 | |
Protein Name | MLP-like protein 28 | |
Gene Name | MLP28 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 335 | |
Subcellular Localization | ||
Protein Description | Can bind steroids (in vitro), and may also bind other types of hydrophobic ligands.. | |
Protein Sequence | MADVATKHPMEDEVKKTEASSLVGKLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGTVGSIVFWNYVHDGEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEHLLAEEEEVKTPETPSLVGKLETDVEIKASAEKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGQVGSIVFWNYVHDREAKVAKERIEAVEPNKNLITFRVIDGDLMKEYKSFLLTIQVTPKLGGPGSIVHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEHLLAEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Phosphorylation | SLVGKLETDVEIKAS HHHCCEECCEEEEEC | 56.64 | 19880383 | |
178 | Phosphorylation | AEEEEVKTPETPSLV CCHHHCCCCCCCCCC | 31.37 | 30291188 | |
181 | Phosphorylation | EEVKTPETPSLVGKL HHCCCCCCCCCCCEE | 21.27 | 23776212 | |
183 | Phosphorylation | VKTPETPSLVGKLET CCCCCCCCCCCEEEC | 43.01 | 23776212 | |
190 | Phosphorylation | SLVGKLETDVEIKAS CCCCEEECCEEEHHH | 56.64 | 24243849 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MLP28_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MLP28_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MLP28_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MLP28_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...