MLP28_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MLP28_ARATH
• UniProt AC: Q9SSK9
• Protein Name: MLP-like protein 28
• Gene Name: MLP28
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 335
• Protein Description: Can bind steroids (in vitro), and may also bind other types of hydrophobic ligands..
• Protein Sequence: MADVATKHPMEDEVKKTEASSLVGKLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGTVGSIVFWNYVHDGEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEHLLAEEEEVKTPETPSLVGKLETDVEIKASAEKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGQVGSIVFWNYVHDREAKVAKERIEAVEPNKNLITFRVIDGDLMKEYKSFLLTIQVTPKLGGPGSIVHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEHLLAEE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
28	Phosphorylation	SLVGKLETDVEIKAS HHHCCEECCEEEEEC	56.64	19880383
178	Phosphorylation	AEEEEVKTPETPSLV CCHHHCCCCCCCCCC	31.37	30291188
181	Phosphorylation	EEVKTPETPSLVGKL HHCCCCCCCCCCCEE	21.27	23776212
183	Phosphorylation	VKTPETPSLVGKLET CCCCCCCCCCCEEEC	43.01	23776212
190	Phosphorylation	SLVGKLETDVEIKAS CCCCEEECCEEEHHH	56.64	24243849

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MLP28_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MLP28_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MLP28_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of MLP28_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.