UniProt ID | MTNA_ARATH | |
---|---|---|
UniProt AC | Q9ZUG4 | |
Protein Name | Methylthioribose-1-phosphate isomerase {ECO:0000255|HAMAP-Rule:MF_03119} | |
Gene Name | At2g05830 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 374 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P).. | |
Protein Sequence | MSGEGDTTLKAICYKPGSLQLLDQRKLPLETIYLEIRDASDGWSAIQEMVVRGAPAIAIAAALSLAVEVFNFHGFDGSASDAVAFLENKLDYLVSSRPTAVNLADAALKLKHVIAKALATATEAKSIFKAYIEASEDMLEDDVVSNKAIGNFGLSLLRQQAKNPDKLSVLTHCNTGSLATAGYGTALGVIRALHTQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELMHTHGGLGERIAAPGISVWNPAFDMTPAELIAGIITEKGVITKNGNDTFDISSFAKKITGNSSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSGEGDTTL ------CCCCCCCCE | 45.62 | 22223895 | |
306 | Phosphorylation | EIVIEERSPKELMHT EEEEEECCHHHHHHC | 43.53 | 30291188 | |
362 | Phosphorylation | GNDTFDISSFAKKIT CCCCEEHHHHHHHHH | 22.65 | 28295753 | |
363 | Phosphorylation | NDTFDISSFAKKITG CCCEEHHHHHHHHHC | 29.56 | 28295753 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTNA_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTNA_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTNA_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MTNA_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...