MTNA_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MTNA_ARATH
• UniProt AC: Q9ZUG4
• Protein Name: Methylthioribose-1-phosphate isomerase {ECO:0000255|HAMAP-Rule:MF_03119}
• Gene Name: At2g05830
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 374
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P)..
• Protein Sequence: MSGEGDTTLKAICYKPGSLQLLDQRKLPLETIYLEIRDASDGWSAIQEMVVRGAPAIAIAAALSLAVEVFNFHGFDGSASDAVAFLENKLDYLVSSRPTAVNLADAALKLKHVIAKALATATEAKSIFKAYIEASEDMLEDDVVSNKAIGNFGLSLLRQQAKNPDKLSVLTHCNTGSLATAGYGTALGVIRALHTQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELMHTHGGLGERIAAPGISVWNPAFDMTPAELIAGIITEKGVITKNGNDTFDISSFAKKITGNSSR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGEGDTTL ------CCCCCCCCE	45.62	22223895
306	Phosphorylation	EIVIEERSPKELMHT EEEEEECCHHHHHHC	43.53	30291188
362	Phosphorylation	GNDTFDISSFAKKIT CCCCEEHHHHHHHHH	22.65	28295753
363	Phosphorylation	NDTFDISSFAKKITG CCCEEHHHHHHHHHC	29.56	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MTNA_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MTNA_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MTNA_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of MTNA_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.