UniProt ID | KRP2_ARATH | |
---|---|---|
UniProt AC | Q9SCR2 | |
Protein Name | Cyclin-dependent kinase inhibitor 2 | |
Gene Name | KRP2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 209 | |
Subcellular Localization | Nucleus, nucleoplasm . Homogeneously distributed. | |
Protein Description | Binds and inhibits CYCD2-1/CDKA-1 complex kinase activity. Regulates cell division which is crucial for plant growth, development and morphogenesis. May regulate early lateral root initiation by blocking the G1/S phase transition. Controls the mitosis-to-endocycle transition and the onset of the endoreduplication cycle during leaf development through inhibition of mitotic CDKA-1 kinase complexes. Specifically targets CDKA-1.. | |
Protein Sequence | MAAVRRRERDVVEENGVTTTTVKRRKMEEEVDLVESRIILSPCVQATNRGGIVARNSAGASETSVVIVRRRDSPPVEEQCQIEEEDSSVSCCSTSEEKSKRRIEFVDLEENNGDDRETETSWIYDDLNKSEESMNMDSSSVAVEDVESRRRLRKSLHETVKEAELEDFFQVAEKDLRNKLLECSMKYNFDFEKDEPLGGGRYEWVKLNP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of KRP2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRP2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRP2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...