UniProt ID | CCD32_ARATH | |
---|---|---|
UniProt AC | Q9FGQ7 | |
Protein Name | Cyclin-D3-2 | |
Gene Name | CYCD3-2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 367 | |
Subcellular Localization | ||
Protein Description | Promotes divisions in the guard cells (GCs) after the guard mother cells (GMC) symmetric division when in the presence of CDKA-1.. | |
Protein Sequence | MALEKEEEASQNGAFCVLDGLYCEEETGFVEDDLDDDGDLDFLEKSDESVVKFQFLPLLDMFLWDDDEILSLISKENETNPCFGEQILDGFLVSCRKEALDWVLRVKSHYGFTSLTAILAVNYFDRFMTSIKLQTDKPWMSQLVAVASLSLAAKVEEIQVPLLLDLQVEEARYLFEAKTIQRMELLILSTLQWRMHPVTPISFFDHIIRRFGSKWHQQLDFCRKCERLLISVIADTRFMRYFPSVLATAIMILVFEELKPCDEVEYQSQITTLLKVNQEKVNECYELLLEHNPSKKRMMNLVDQDSPSGVLDFDDSSNSSWNVSTTASVSSSSSSPEPLLKRRRVQEQQMRLPSINRMFLDVLSSPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
190 | Phosphorylation | MELLILSTLQWRMHP HHHHHHHHCCHHCCC | 21.37 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCD32_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCD32_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCD32_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CKB21_ARATH | CDKB2;1 | physical | 20407024 | |
CKS1_ARATH | CKS1 | physical | 20407024 | |
CCA21_ARATH | CYCA2;1 | physical | 20407024 | |
CCB23_ARATH | CYCB2;3 | physical | 20407024 | |
E2FF_ARATH | DEL3 | physical | 20407024 | |
DPA_ARATH | DPA | physical | 20407024 | |
KRP4_ARATH | KRP4 | physical | 20407024 | |
CDKA1_ARATH | CDC2 | physical | 20706207 | |
CKS2_ARATH | CKS2 | physical | 20706207 | |
CKS1_ARATH | CKS1 | physical | 20706207 | |
RQSIM_ARATH | RECQSIM | physical | 20706207 | |
PPR1_ARATH | AT1G01970 | physical | 20706207 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...