UniProt ID | CCD31_ARATH | |
---|---|---|
UniProt AC | P42753 | |
Protein Name | Cyclin-D3-1 | |
Gene Name | CYCD3-1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 376 | |
Subcellular Localization | ||
Protein Description | Involved in the control of the cell cycle at the G1/S (start) transition. Activates the G1/S phase transition in response to cytokinin hormone signal, but declines in response to sucrose starvation leading to G1 arrest. Involved in the induction of mitotic cell division. Plays an important role in the switch from cell proliferation to the final stages of differentiation during plant development. May not be involved in the activation of cell cycle in the root apical meristem (RAM) in the early phase of seed germination. Promotes divisions in the guard cells (GCs) after the guard mother cells (GMC) symmetric division. [PubMed: 24687979] | |
Protein Sequence | MAIRKEEESREEQSNSFLLDALYCEEEKWDDEGEEVEENSSLSSSSSPFVVLQQDLFWEDEDLVTLFSKEEEQGLSCLDDVYLSTDRKEAVGWILRVNAHYGFSTLAAVLAITYLDKFICSYSLQRDKPWMLQLVSVACLSLAAKVEETQVPLLLDFQVEETKYVFEAKTIQRMELLILSTLEWKMHLITPISFVDHIIRRLGLKNNAHWDFLNKCHRLLLSVISDSRFVGYLPSVVAAATMMRIIEQVDPFDPLSYQTNLLGVLNLTKEKVKTCYDLILQLPVDRIGLQIQIQSSKKRKSHDSSSSLNSPSCVIDANPFNSDESSNDSWSASSCNPPTSSSSPQQQPPLKKMRGAEENEKKKPILHLPWAIVATP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of CCD31_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCD31_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCD31_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCD31_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KRP1_ARATH | ICK1 | physical | 9753775 | |
CDKA1_ARATH | CDC2 | physical | 17426018 | |
CKS2_ARATH | CKS2 | physical | 17426018 | |
KRP6_ARATH | KRP6 | physical | 17426018 | |
KRP2_ARATH | KRP2 | physical | 10758489 | |
CDKA1_ARATH | CDC2 | physical | 20706207 | |
CKS2_ARATH | CKS2 | physical | 20706207 | |
KRP6_ARATH | KRP6 | physical | 20706207 | |
Y5815_ARATH | AT5G58150 | physical | 20706207 | |
RB45A_ARATH | RBP45A | physical | 20706207 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...