RB45A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RB45A_ARATH
• UniProt AC: Q9FPJ8
• Protein Name: Polyadenylate-binding protein RBP45A
• Gene Name: RBP45A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 387
• Subcellular Localization: Nucleus.
• Protein Description: Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation..
• Protein Sequence: MQQPPSNAAGAGQIPSGQQHLWMMMQQQQQQQQMQLSAAPLGQHQYGIGSQNPGSASDVKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQSEGYGFIEFVSHSVAERVLQTYNGAPMPSTEQTFRLNWAQAGAGEKRFQTEGPDHTIFVGDLAPEVTDYMLSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRFADENEQMRAMTEMNGQYCSTRPMRIGPAANKNALPMQPAMYQNTQGANAGDNDPNNTTIFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQLGGQSIRLSWGRSPNKQSDQAQWNGGGYYGYPPQPQGGYGYAAQPPTQDPNAYYGGYTGYGNYQQQRQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
210	Sulfoxidation	FADENEQMRAMTEMN ECCHHHHHHHHHHHC	2.11	23289948
328	Phosphorylation	GGQSIRLSWGRSPNK CCEEEEEEECCCCCC	20.03	27643528
332	Phosphorylation	IRLSWGRSPNKQSDQ EEEEECCCCCCCCCC	28.96	30589143

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RB45A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RB45A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RB45A_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RB45A_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.