UniProt ID | KRP1_ARATH | |
---|---|---|
UniProt AC | Q67Y93 | |
Protein Name | Cyclin-dependent kinase inhibitor 1 | |
Gene Name | KRP1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 191 | |
Subcellular Localization | Nucleus, nucleoplasm . Distributed in a ponctuate pattern and in heterochromatic chromocenters. | |
Protein Description | Binds and inhibits CYCD2-1/CDKA-1 kinase complex activity. Regulates cell division which is crucial for plant growth, development and morphogenesis. Functions in turning cells from a mitotic to an endoreplicating cell cycle mode. Acts cell- and non-cell-autonomously to regulate endoreduplication by allowing S phase progression, but blocking entry into mitosis. Keeps on the one hand the plant cell cycle locally controlled, and on the other hand provides a possibility of linking cell cycle control in single cells with the supracellular organization of a tissue or an organ. May target specifically CDKA-1.. | |
Protein Sequence | MVRKYRKAKGIVEAGVSSTYMQLRSRRIVYVRSEKSSSVSVVGDNGVSSSCSGSNEYKKKELIHLEEEDKDGDTETSTYRRGTKRKLFENLREEEKEELSKSMENYSSEFESAVKESLDCCCSGRKTMEETVTAEEEEKAKLMTEMPTESEIEDFFVEAEKQLKEKFKKKYNFDFEKEKPLEGRYEWVKLE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRP1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRP1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...