KRP1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KRP1_ARATH
• UniProt AC: Q67Y93
• Protein Name: Cyclin-dependent kinase inhibitor 1
• Gene Name: KRP1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 191
• Subcellular Localization: Nucleus, nucleoplasm . Distributed in a ponctuate pattern and in heterochromatic chromocenters.
• Protein Description: Binds and inhibits CYCD2-1/CDKA-1 kinase complex activity. Regulates cell division which is crucial for plant growth, development and morphogenesis. Functions in turning cells from a mitotic to an endoreplicating cell cycle mode. Acts cell- and non-cell-autonomously to regulate endoreduplication by allowing S phase progression, but blocking entry into mitosis. Keeps on the one hand the plant cell cycle locally controlled, and on the other hand provides a possibility of linking cell cycle control in single cells with the supracellular organization of a tissue or an organ. May target specifically CDKA-1..
• Protein Sequence: MVRKYRKAKGIVEAGVSSTYMQLRSRRIVYVRSEKSSSVSVVGDNGVSSSCSGSNEYKKKELIHLEEEDKDGDTETSTYRRGTKRKLFENLREEEKEELSKSMENYSSEFESAVKESLDCCCSGRKTMEETVTAEEEEKAKLMTEMPTESEIEDFFVEAEKQLKEKFKKKYNFDFEKEKPLEGRYEWVKLE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	Phosphorylation	VRSEKSSSVSVVGDN EEECCCCCEEEECCC	26.04	28011693
40	Phosphorylation	SEKSSSVSVVGDNGV ECCCCCEEEECCCCC	17.03	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	RKP	Q9SIZ8	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KRP1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KRP1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDKA1_ARATH	CDC2	physical	9753775
CCD31_ARATH	CYCD3;1	physical	9753775
RKP_ARATH	RKP	physical	19000158
CDKA1_ARATH	CDC2	physical	20407024
CKS2_ARATH	CKS2	physical	20407024
CCD31_ARATH	CYCD3;1	physical	20407024
CCD21_ARATH	CYCD2;1	physical	20407024
CCA23_ARATH	CYCA2;3	physical	20407024
CCA24_ARATH	CYCA2;4	physical	20407024
CCA31_ARATH	CYCA3;1	physical	20407024
CCA32_ARATH	CYCA3;2	physical	20407024
CCA34_ARATH	CYCA3;4	physical	20407024
CCD32_ARATH	CYCD3;2	physical	20407024
CCD33_ARATH	CYCD3;3	physical	20407024
CCD41_ARATH	CYCD4;1	physical	20407024
CCD42_ARATH	CYCD4;2	physical	20407024
CCD51_ARATH	CYCD5;1	physical	20407024
CCD61_ARATH	CYCD6;1	physical	20407024
CCH11_ARATH	CYCH;1	physical	20407024
CKB21_ARATH	CDKB2;1	physical	20407024
CDKF1_ARATH	CAK1AT	physical	20407024
CKS1_ARATH	CKS1	physical	20407024
E2FE_ARATH	DEL1	physical	20407024
E2FD_ARATH	DEL2	physical	20407024
CDKA1_ARATH	CDC2	physical	20706207
ACBP4_ARATH	ACBP4	physical	20706207
CDKA1_ARATH	CDC2	physical	18005227
CCD21_ARATH	CYCD2;1	physical	18005227

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.