UniProt ID | CCD21_ARATH | |
---|---|---|
UniProt AC | P42752 | |
Protein Name | Cyclin-D2-1 | |
Gene Name | CYCD2-1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 361 | |
Subcellular Localization | ||
Protein Description | Acts on the G1 phase of the cell cycle to control cell division rate in both shoot and root meristems. The complex formed with CDKA-1 phosphorylates plant retinoblastoma protein.. | |
Protein Sequence | MAENLACGETSESWIIDNDDDDINYGGGFTNEIDYNHQLFAKDDNFGGNGSIPMMGSSSSSLSEDRIKEMLVREIEFCPGTDYVKRLLSGDLDLSVRNQALDWILKVCAHYHFGHLCICLSMNYLDRFLTSYELPKDKDWAAQLLAVSCLSLASKMEETDVPHIVDLQVEDPKFVFEAKTIKRMELLVVTTLNWRLQALTPFSFIDYFVDKISGHVSENLIYRSSRFILNTTKAIEFLDFRPSEIAAAAAVSVSISGETECIDEEKALSSLIYVKQERVKRCLNLMRSLTGEENVRGTSLSQEQARVAVRAVPASPVGVLEATCLSYRSEERTVESCTNSSQSSPDNNNNNNNSNKRRRKQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of CCD21_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCD21_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCD21_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCD21_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDKD2_ARATH | CAK4 | physical | 20407024 | |
CKS2_ARATH | CKS2 | physical | 20706207 | |
KRP4_ARATH | KRP4 | physical | 20706207 | |
CDKA1_ARATH | CDC2 | physical | 20706207 | |
G6PD2_ARATH | G6PD2 | physical | 20706207 | |
AB1F_ARATH | GCN1 | physical | 20706207 | |
BCAL1_ARATH | AT3G05190 | physical | 20706207 | |
ANXD8_ARATH | ANNAT8 | physical | 20706207 | |
RH9_ARATH | PMH1 | physical | 20706207 | |
CFIS2_ARATH | AT4G25550 | physical | 20706207 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...