CCD21_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCD21_ARATH
• UniProt AC: P42752
• Protein Name: Cyclin-D2-1
• Gene Name: CYCD2-1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 361
• Protein Description: Acts on the G1 phase of the cell cycle to control cell division rate in both shoot and root meristems. The complex formed with CDKA-1 phosphorylates plant retinoblastoma protein..
• Protein Sequence: MAENLACGETSESWIIDNDDDDINYGGGFTNEIDYNHQLFAKDDNFGGNGSIPMMGSSSSSLSEDRIKEMLVREIEFCPGTDYVKRLLSGDLDLSVRNQALDWILKVCAHYHFGHLCICLSMNYLDRFLTSYELPKDKDWAAQLLAVSCLSLASKMEETDVPHIVDLQVEDPKFVFEAKTIKRMELLVVTTLNWRLQALTPFSFIDYFVDKISGHVSENLIYRSSRFILNTTKAIEFLDFRPSEIAAAAAVSVSISGETECIDEEKALSSLIYVKQERVKRCLNLMRSLTGEENVRGTSLSQEQARVAVRAVPASPVGVLEATCLSYRSEERTVESCTNSSQSSPDNNNNNNNSNKRRRKQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CCD21_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCD21_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCD21_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCD21_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDKD2_ARATH	CAK4	physical	20407024
CKS2_ARATH	CKS2	physical	20706207
KRP4_ARATH	KRP4	physical	20706207
CDKA1_ARATH	CDC2	physical	20706207
G6PD2_ARATH	G6PD2	physical	20706207
AB1F_ARATH	GCN1	physical	20706207
BCAL1_ARATH	AT3G05190	physical	20706207
ANXD8_ARATH	ANNAT8	physical	20706207
RH9_ARATH	PMH1	physical	20706207
CFIS2_ARATH	AT4G25550	physical	20706207

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.