UniProt ID | G6PD2_ARATH | |
---|---|---|
UniProt AC | Q9FY99 | |
Protein Name | Glucose-6-phosphate 1-dehydrogenase 2, chloroplastic | |
Gene Name | At5g13110 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 596 | |
Subcellular Localization | Plastid, chloroplast. | |
Protein Description | Catalyzes the rate-limiting step of the oxidative pentose-phosphate pathway, which represents a route for the dissimilation of carbohydrates besides glycolysis. The main function of this enzyme is to provide reducing power (NADPH) and pentose phosphates for fatty acid and nucleic acid synthesis which are involved in membrane synthesis and cell division.. | |
Protein Sequence | MAALSSSVTTRSYHSGYLASFSPVNGDRHRSLSFLSASPQGLNPLDLCVRFQRKSGRASVFMQDGAIVTNSNSSESKTSLKGLKDEVLSALSQEAAKVGVESDGQSQSTVSITVVGASGDLAKKKIFPALFALYYEGCLPEHFTIFGYSRSKMTDVELRNMVSKTLTCRIDKRANCGEKMEEFLKRCFYHSGQYDSQEHFTELDKKLKEHEAGRISNRLFYLSIPPNIFVDAVKCASTSASSVNGWTRVIVEKPFGRDSETSAALTKSLKQYLEEDQIFRIDHYLGKELVENLSVLRFSNLIFEPLWSRQYIRNVQFIFSEDFGTEGRGGYFDNYGIIRDIMQNHLLQILALFAMETPVSLDAEDIRNEKVKVLRSMRPIRVEDVVIGQYKSHTKGGVTYPAYTDDKTVPKGSLTPTFAAAALFIDNARWDGVPFLMKAGKALHTRSAEIRVQFRHVPGNLYNRNTGSDLDQATNELVIRVQPDEAIYLKINNKVPGLGMRLDRSNLNLLYSARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWSLFTPLLKEIEEKKRIPEYYPYGSRGPVGAHYLAAKHKVQWGDVSIDQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | AALSSSVTTRSYHSG CCCCCCCCCCEECCC | 20.59 | 19880383 | |
10 | Phosphorylation | ALSSSVTTRSYHSGY CCCCCCCCCEECCCE | 18.57 | 19880383 | |
60 | Acetylation | RKSGRASVFMQDGAI ECCCCCEEEEECCCE | 4.52 | 22223895 | |
111 | Phosphorylation | GQSQSTVSITVVGAS CCCCCEEEEEEEECC | 16.78 | 28011693 | |
113 | Phosphorylation | SQSTVSITVVGASGD CCCEEEEEEEECCCH | 11.13 | 28011693 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of G6PD2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of G6PD2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of G6PD2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of G6PD2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...