dbPTM

G6PD2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	G6PD2_ARATH
UniProt AC	Q9FY99
Protein Name	Glucose-6-phosphate 1-dehydrogenase 2, chloroplastic
Gene Name	At5g13110
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	596
Subcellular Localization	Plastid, chloroplast.
Protein Description	Catalyzes the rate-limiting step of the oxidative pentose-phosphate pathway, which represents a route for the dissimilation of carbohydrates besides glycolysis. The main function of this enzyme is to provide reducing power (NADPH) and pentose phosphates for fatty acid and nucleic acid synthesis which are involved in membrane synthesis and cell division..
Protein Sequence	MAALSSSVTTRSYHSGYLASFSPVNGDRHRSLSFLSASPQGLNPLDLCVRFQRKSGRASVFMQDGAIVTNSNSSESKTSLKGLKDEVLSALSQEAAKVGVESDGQSQSTVSITVVGASGDLAKKKIFPALFALYYEGCLPEHFTIFGYSRSKMTDVELRNMVSKTLTCRIDKRANCGEKMEEFLKRCFYHSGQYDSQEHFTELDKKLKEHEAGRISNRLFYLSIPPNIFVDAVKCASTSASSVNGWTRVIVEKPFGRDSETSAALTKSLKQYLEEDQIFRIDHYLGKELVENLSVLRFSNLIFEPLWSRQYIRNVQFIFSEDFGTEGRGGYFDNYGIIRDIMQNHLLQILALFAMETPVSLDAEDIRNEKVKVLRSMRPIRVEDVVIGQYKSHTKGGVTYPAYTDDKTVPKGSLTPTFAAAALFIDNARWDGVPFLMKAGKALHTRSAEIRVQFRHVPGNLYNRNTGSDLDQATNELVIRVQPDEAIYLKINNKVPGLGMRLDRSNLNLLYSARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWSLFTPLLKEIEEKKRIPEYYPYGSRGPVGAHYLAAKHKVQWGDVSIDQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	AALSSSVTTRSYHSG CCCCCCCCCCEECCC	20.59	19880383
10	Phosphorylation	ALSSSVTTRSYHSGY CCCCCCCCCEECCCE	18.57	19880383
60	Acetylation	RKSGRASVFMQDGAI ECCCCCEEEEECCCE	4.52	22223895
111	Phosphorylation	GQSQSTVSITVVGAS CCCCCEEEEEEEECC	16.78	28011693
113	Phosphorylation	SQSTVSITVVGASGD CCCEEEEEEEECCCH	11.13	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of G6PD2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of G6PD2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of G6PD2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of G6PD2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of G6PD2_ARATH

Related Literatures of Post-Translational Modification