dbPTM

CFIS2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CFIS2_ARATH
UniProt AC	Q8GXS3
Protein Name	Pre-mRNA cleavage factor Im 25 kDa subunit 2 {ECO:0000303\|PubMed:18479511}
Gene Name	CFIS2 {ECO:0000303\|PubMed:18479511}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	200
Subcellular Localization	Nucleus . In punctate subnuclear structures localized adjacent to nuclear speckles, called paraspeckles.
Protein Description	Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export..
Protein Sequence	MAMSQVVNTYPLSNYSFGTKEPKLEKDTSVADRLARMKINYMKEGMRTSVEGILLVQEHNHPHILLLQIGNTFCKLPGGRLKPGENEADGLKRKLTSKLGGNSAALVPDWTVGECVATWWRPNFETMMYPYCPPHITKPKECKRLYIVHLSEKEYFAVPKNLKLLAVPLFELYDNVQRYGPVISTIPQQLSRFHFNMISS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CFIS2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CFIS2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CFIS2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CFIS2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
FIPS5_ARATH	FIP1[V]	physical	18479511

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CFIS2_ARATH

Related Literatures of Post-Translational Modification