KRP6_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KRP6_ARATH
• UniProt AC: Q0WNX9
• Protein Name: Cyclin-dependent kinase inhibitor 6
• Gene Name: KRP6
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 196
• Subcellular Localization: Nucleus, nucleoplasm . Homogeneously distributed. Present in microspores and accumulates strongly in vegetative cell nuclei immediately after asymmetric division and disappears later.
• Protein Description: Binds and inhibits CYCD2-1/CDKA-1 complex kinase activity. Regulates cell division which is crucial for plant growth, development and morphogenesis. May inhibit CDK kinases specifically involved in the G1/S phase transition..
• Protein Sequence: MSERKRELAEEASSTSFSPLKKTKLNDSSDSSPDSHDVIVFAVSSSSVASSAALASDECSVTIGGEESDQSSSISSGCFTSESKEIAKNSSSFGVDLEDHQIETETETSTFITSNFRKETSPVSEGLGETTTEMESSSATKRKQPGVRKTPTAAEIEDLFSELESQDDKKKQFIEKYNFDIVNDEPLEGRYKWDRL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
152	Phosphorylation	PGVRKTPTAAEIEDL CCCCCCCCHHHHHHH	43.67	14993207

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
152	T	Phosphorylation	Kinase	KIN10	Q38997	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
152	T	Phosphorylation	The phosphorylation at Thr-152 by KIN10 represses its activity.	23617622

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KRP6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RKP_ARATH	RKP	physical	19000158
CCD41_ARATH	CYCD4;1	physical	20407024
CCD11_ARATH	CYCD1;1	physical	20407024
CCD21_ARATH	CYCD2;1	physical	20407024
CCD31_ARATH	CYCD3;1	physical	20407024
CCD33_ARATH	CYCD3;3	physical	20407024
CCD42_ARATH	CYCD4;2	physical	20407024
CCD51_ARATH	CYCD5;1	physical	20407024
CCD61_ARATH	CYCD6;1	physical	20407024
CCH11_ARATH	CYCH;1	physical	20407024
CCD21_ARATH	CYCD2;1	physical	20706207
CCD41_ARATH	CYCD4;1	physical	20706207
GUN9_ARATH	CEL3	physical	20706207
RB45A_ARATH	RBP45A	physical	20706207
FBL17_ARATH	FBL17	physical	18948957

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.