VIP1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VIP1_ARATH
• UniProt AC: Q9MA75
• Protein Name: Transcription factor VIP1
• Gene Name: VIP1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 341
• Subcellular Localization: Cytoplasm. Nucleus. Confined to nucleus when phosphorylated.
• Protein Description: Transcription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions..
• Protein Sequence: MEGGGRGPNQTILSEIEHMPEAPRQRISHHRRARSETFFSGESIDDLLLFDPSDIDFSSLDFLNAPPPPQQSQQQPQASPMSVDSEETSSNGVVPPNSLPPKPEARFGRHVRSFSVDSDFFDDLGVTEEKFIATSSGEKKKGNHHHSRSNSMDGEMSSASFNIESILASVSGKDSGKKNMGMGGDRLAELALLDPKRAKRILANRQSAARSKERKIRYTGELERKVQTLQNEATTLSAQVTMLQRGTSELNTENKHLKMRLQALEQQAELRDALNEALRDELNRLKVVAGEIPQGNGNSYNRAQFSSQQSAMNQFGNKTNQQMSTNGQPSLPSYMDFTKRG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
79	Phosphorylation	SQQQPQASPMSVDSE CCCCCCCCCCCCCCC	18.85	17947581
113	Phosphorylation	RFGRHVRSFSVDSDF HCCCCCCEEEECCCC	22.30	23776212
115	Phosphorylation	GRHVRSFSVDSDFFD CCCCCEEEECCCCCC	26.68	30291188
118	Phosphorylation	VRSFSVDSDFFDDLG CCEEEECCCCCCCCC	33.87	23776212
127	Phosphorylation	FFDDLGVTEEKFIAT CCCCCCCCCCEEEEC	36.31	19376835
134	Phosphorylation	TEEKFIATSSGEKKK CCCEEEECCCCCCCC	20.71	30407730
135	Phosphorylation	EEKFIATSSGEKKKG CCEEEECCCCCCCCC	27.59	30407730
136	Phosphorylation	EKFIATSSGEKKKGN CEEEECCCCCCCCCC	46.76	30407730
149	Phosphorylation	GNHHHSRSNSMDGEM CCCCCCCCCCCCCCC	35.95	23776212
151	Phosphorylation	HHHSRSNSMDGEMSS CCCCCCCCCCCCCCC	21.35	23776212
157	Phosphorylation	NSMDGEMSSASFNIE CCCCCCCCCCEEEHH	20.60	23776212
158	Phosphorylation	SMDGEMSSASFNIES CCCCCCCCCEEEHHH	26.99	23776212
160	Phosphorylation	DGEMSSASFNIESIL CCCCCCCEEEHHHHH	22.30	23776212
165	Phosphorylation	SASFNIESILASVSG CCEEEHHHHHHHHCC	21.07	23776212
169	Phosphorylation	NIESILASVSGKDSG EHHHHHHHHCCCCCC	17.23	23172892
171	Phosphorylation	ESILASVSGKDSGKK HHHHHHHCCCCCCCC	37.32	23172892
175	Phosphorylation	ASVSGKDSGKKNMGM HHHCCCCCCCCCCCC	56.87	23172892

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VIP1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VIP1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VIP1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBB_ARATH	AGB1	physical	23974356
VIP1_ARATH	VIP1	physical	24057918
VIP1_ARATH	VIP1	physical	25093810
POF21_ARATH	AT2G31370	physical	25093810
MPK3_ARATH	MPK3	physical	17947581

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Trojan horse strategy in Agrobacterium transformation: abusing MAPKdefense signaling.";
Djamei A., Pitzschke A., Nakagami H., Rajh I., Hirt H.;
Science 318:453-456(2007).
Cited for: FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-79, INTERACTIONWITH MPK3, AND MUTAGENESIS OF SER-79.
PubMed: 17947581