dbPTM

KRP5_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KRP5_ARATH
UniProt AC	Q9LRY0
Protein Name	Cyclin-dependent kinase inhibitor 5
Gene Name	KRP5
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	189
Subcellular Localization	Nucleus, nucleoplasm . Distributed in a ponctuate pattern.
Protein Description	Inhibits CYCD2-1/CDKA-1 complex kinase activity without interaction with the complex..
Protein Sequence	MGKYIKKSKVAGAVSVKDKSHPPALGFRTRAAAAKNLALHRLRSHSDEADSFNYLQLRSRRLVKLPLLTNTRKQQKQQLIPSVNQCQTKNPRASSGPAKKLEPDTTTEEACGDNERISRSDCNFGDKGFDLESENRSMISDSKSIQSEIEDFFASAEQQQQRFFIQKYNFDIVSDNPLPGRYEWVKVMP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of KRP5_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KRP5_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KRP5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KRP5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CCD41_ARATH	CYCD4;1	physical	20407024
CCD11_ARATH	CYCD1;1	physical	20407024
CCD21_ARATH	CYCD2;1	physical	20407024
CCD42_ARATH	CYCD4;2	physical	20407024
CCD51_ARATH	CYCD5;1	physical	20407024
CCD61_ARATH	CYCD6;1	physical	20407024
CCH11_ARATH	CYCH;1	physical	20407024
CCD21_ARATH	CYCD2;1	physical	20706207
CDKA1_ARATH	CDC2	physical	20706207
CCD41_ARATH	CYCD4;1	physical	20706207
EF115_ARATH	AT5G07310	physical	20706207
SNF12_ARATH	CHC1	physical	20706207
UBA2A_ARATH	UBA2A	physical	20706207

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KRP5_ARATH

Related Literatures of Post-Translational Modification