UniProt ID | KRP5_ARATH | |
---|---|---|
UniProt AC | Q9LRY0 | |
Protein Name | Cyclin-dependent kinase inhibitor 5 | |
Gene Name | KRP5 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 189 | |
Subcellular Localization | Nucleus, nucleoplasm . Distributed in a ponctuate pattern. | |
Protein Description | Inhibits CYCD2-1/CDKA-1 complex kinase activity without interaction with the complex.. | |
Protein Sequence | MGKYIKKSKVAGAVSVKDKSHPPALGFRTRAAAAKNLALHRLRSHSDEADSFNYLQLRSRRLVKLPLLTNTRKQQKQQLIPSVNQCQTKNPRASSGPAKKLEPDTTTEEACGDNERISRSDCNFGDKGFDLESENRSMISDSKSIQSEIEDFFASAEQQQQRFFIQKYNFDIVSDNPLPGRYEWVKVMP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of KRP5_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRP5_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRP5_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRP5_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CCD41_ARATH | CYCD4;1 | physical | 20407024 | |
CCD11_ARATH | CYCD1;1 | physical | 20407024 | |
CCD21_ARATH | CYCD2;1 | physical | 20407024 | |
CCD42_ARATH | CYCD4;2 | physical | 20407024 | |
CCD51_ARATH | CYCD5;1 | physical | 20407024 | |
CCD61_ARATH | CYCD6;1 | physical | 20407024 | |
CCH11_ARATH | CYCH;1 | physical | 20407024 | |
CCD21_ARATH | CYCD2;1 | physical | 20706207 | |
CDKA1_ARATH | CDC2 | physical | 20706207 | |
CCD41_ARATH | CYCD4;1 | physical | 20706207 | |
EF115_ARATH | AT5G07310 | physical | 20706207 | |
SNF12_ARATH | CHC1 | physical | 20706207 | |
UBA2A_ARATH | UBA2A | physical | 20706207 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...