UniProt ID | CDKD3_ARATH | |
---|---|---|
UniProt AC | Q9LMT0 | |
Protein Name | Cyclin-dependent kinase D-3 | |
Gene Name | CDKD-3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 391 | |
Subcellular Localization | Nucleus . | |
Protein Description | May form a stable complex with cyclin CYCH1-1 that phosphorylates human CDK2 and the C-terminal domain (CTD) of the large subunit of RNA polymerase II.. | |
Protein Sequence | MPEQPKKVADRYLKQEVLGQGTYGVVFKATDTKTEQTVAIKKIRLGKQREGVNITALREIKMLKELKHPHIILLIDAFPHKENLHLVFEFMETDLEAVIRDSNIFLSPADIKSYLLMTFKGLAYCHDKWVLHRDMKPNNLLIGVDGQLKLADFGLARIFGSPNRKFTHQVFARWYRAPELLFGAKQYGAAVDVWAVACIFAELLLRRPFLQGNSDIDQLSKIFAAFGTPKADQWPDLTKLPDYVEYQFVPAPSLRSLFPAVSDDALDLLSKMFTYDPKARISIKQALEHRYFTSAPAPTDPAKLPKPVPKQDGKSSYGKHEAITVQSPPRKLRRVMPERGRVDSLKSHVDKDQQAPMSLDFTILAERPPNRPTITSADRSHLKRKLDLEFQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Phosphorylation | EVLGQGTYGVVFKAT HHHCCCCEEEEEEEE | 18.10 | 16856985 | |
161 | Phosphorylation | GLARIFGSPNRKFTH HHHHHHCCCCCCHHH | 14.30 | 23776212 | |
167 | Phosphorylation | GSPNRKFTHQVFARW CCCCCCHHHHHHHHH | 17.90 | 16856985 | |
327 | Phosphorylation | HEAITVQSPPRKLRR CCEEEECCCCHHHHH | 32.32 | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
161 | S | Phosphorylation | Kinase | CDK7 | - | GPS |
161 | S | Phosphorylation | Kinase | CAK | - | Uniprot |
167 | T | Phosphorylation | Kinase | CDK7 | - | GPS |
167 | T | Phosphorylation | Kinase | CAK | - | Uniprot |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDKD3_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"The plant-specific kinase CDKF;1 is involved in activatingphosphorylation of cyclin-dependent kinase-activating kinases inArabidopsis."; Shimotohno A., Umeda-Hara C., Bisova K., Uchimiya H., Umeda M.; Plant Cell 16:2954-2966(2004). Cited for: FUNCTION, ENZYME REGULATION, SUBCELLULAR LOCATION, INTERACTION WITHCYCH1-1, PHOSPHORYLATION AT SER-161 AND THR-167, AND MUTAGENESIS OFLYS-41; SER-161 AND THR-167. |