dbPTM

CDKD3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CDKD3_ARATH
UniProt AC	Q9LMT0
Protein Name	Cyclin-dependent kinase D-3
Gene Name	CDKD-3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	391
Subcellular Localization	Nucleus .
Protein Description	May form a stable complex with cyclin CYCH1-1 that phosphorylates human CDK2 and the C-terminal domain (CTD) of the large subunit of RNA polymerase II..
Protein Sequence	MPEQPKKVADRYLKQEVLGQGTYGVVFKATDTKTEQTVAIKKIRLGKQREGVNITALREIKMLKELKHPHIILLIDAFPHKENLHLVFEFMETDLEAVIRDSNIFLSPADIKSYLLMTFKGLAYCHDKWVLHRDMKPNNLLIGVDGQLKLADFGLARIFGSPNRKFTHQVFARWYRAPELLFGAKQYGAAVDVWAVACIFAELLLRRPFLQGNSDIDQLSKIFAAFGTPKADQWPDLTKLPDYVEYQFVPAPSLRSLFPAVSDDALDLLSKMFTYDPKARISIKQALEHRYFTSAPAPTDPAKLPKPVPKQDGKSSYGKHEAITVQSPPRKLRRVMPERGRVDSLKSHVDKDQQAPMSLDFTILAERPPNRPTITSADRSHLKRKLDLEFQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Phosphorylation	EVLGQGTYGVVFKAT HHHCCCCEEEEEEEE	18.10	16856985
161	Phosphorylation	GLARIFGSPNRKFTH HHHHHHCCCCCCHHH	14.30	23776212
167	Phosphorylation	GSPNRKFTHQVFARW CCCCCCHHHHHHHHH	17.90	16856985
327	Phosphorylation	HEAITVQSPPRKLRR CCEEEECCCCHHHHH	32.32	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
161	S	Phosphorylation	Kinase	CDK7	-	GPS
161	S	Phosphorylation	Kinase	CAK	-	Uniprot
167	T	Phosphorylation	Kinase	CDK7	-	GPS
167	T	Phosphorylation	Kinase	CAK	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
161	S	Phosphorylation	15486101
Phosphorylated by CDKF-1 at Ser-161 and Thr-167.
167	T	Phosphorylation	15486101
Phosphorylated by CDKF-1 at Ser-161 and Thr-167.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CDKD3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDKF1_ARATH	CAK1AT	physical	20407024
CCH11_ARATH	CYCH;1	physical	20407024
CKS1_ARATH	CKS1	physical	20407024
CKS2_ARATH	CKS2	physical	20407024
CCA11_ARATH	CYCA1;1	physical	20407024
CCA21_ARATH	CYCA2;1	physical	20407024
CCA22_ARATH	CYC3B	physical	20407024
CCA23_ARATH	CYCA2;3	physical	20407024
CCA24_ARATH	CYCA2;4	physical	20407024
CCA31_ARATH	CYCA3;1	physical	20407024
CCA32_ARATH	CYCA3;2	physical	20407024
CCA34_ARATH	CYCA3;4	physical	20407024
CCB13_ARATH	CYCB1;3	physical	20407024
CCB23_ARATH	CYCB2;3	physical	20407024
CCD41_ARATH	CYCD4;1	physical	20407024
CCD51_ARATH	CYCD5;1	physical	20407024
CCD61_ARATH	CYCD6;1	physical	20407024
E2FA_ARATH	E2F3	physical	20407024
KRP1_ARATH	ICK1	physical	20407024
KRP2_ARATH	KRP2	physical	20407024
KRP3_ARATH	ICK6	physical	20407024
KRP4_ARATH	KRP4	physical	20407024
KRP5_ARATH	ICK3	physical	20407024
KRP6_ARATH	KRP6	physical	20407024
KRP7_ARATH	ICK5	physical	20407024
CCH11_ARATH	CYCH;1	physical	20706207
PGMC1_ARATH	AT1G23190	physical	20706207
PAP1_ARATH	FIB	physical	21798944
CDKF1_ARATH	CAK1AT	physical	21798944
CDKD1_ARATH	CDKD1;1	genetic	25942995

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CDKD3_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"The plant-specific kinase CDKF;1 is involved in activatingphosphorylation of cyclin-dependent kinase-activating kinases inArabidopsis."; Shimotohno A., Umeda-Hara C., Bisova K., Uchimiya H., Umeda M.; Plant Cell 16:2954-2966(2004). Cited for: FUNCTION, ENZYME REGULATION, SUBCELLULAR LOCATION, INTERACTION WITHCYCH1-1, PHOSPHORYLATION AT SER-161 AND THR-167, AND MUTAGENESIS OFLYS-41; SER-161 AND THR-167.	15486101 [Abstract]