| UniProt ID | KRP7_ARATH | |
|---|---|---|
| UniProt AC | Q94CL9 | |
| Protein Name | Cyclin-dependent kinase inhibitor 7 | |
| Gene Name | KRP7 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 195 | |
| Subcellular Localization | Nucleus, nucleoplasm . Homogeneously distributed. Accumulates strongly in vegetative cell nuclei immediately after asymmetric division and disappears later. | |
| Protein Description | Binds and inhibits CYCD2-1/CDKA-1 complex kinase activity. May target specifically CDKA-1.. | |
| Protein Sequence | MSETKPKRDSEYEGSNIKRMRLDDDDDVLRSPTRTLSSSSSSSLAYSVSDSGGFCSVALSEEEDDHLSSSISSGCSSSETNEIATRLPFSDLEAHEISETEISTLLTNNFRKQGISSSENLGETAEMDSATTEMRDQRKTEKKKKMEKSPTQAELDDFFSAAERYEQKRFTEKYNYDIVNDTPLEGRYQWVSLKP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 151 | Phosphorylation | KKMEKSPTQAELDDF HHHCCCCCHHHHHHH | 47.72 | 23617622 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 151 | T | Phosphorylation | Kinase | KIN10 | Q38997 | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRP7_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRP7_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RKP_ARATH | RKP | physical | 19000158 | |
| CCD41_ARATH | CYCD4;1 | physical | 20407024 | |
| CCD11_ARATH | CYCD1;1 | physical | 20407024 | |
| CCD33_ARATH | CYCD3;3 | physical | 20407024 | |
| CCD42_ARATH | CYCD4;2 | physical | 20407024 | |
| CCD51_ARATH | CYCD5;1 | physical | 20407024 | |
| CCD61_ARATH | CYCD6;1 | physical | 20407024 | |
| CCH11_ARATH | CYCH;1 | physical | 20407024 | |
| CDKA1_ARATH | CDC2 | physical | 20706207 | |
| CKS1_ARATH | CKS1 | physical | 20706207 | |
| CCD21_ARATH | CYCD2;1 | physical | 20706207 | |
| CCD41_ARATH | CYCD4;1 | physical | 20706207 | |
| CCD51_ARATH | CYCD5;1 | physical | 20706207 | |
| GUN9_ARATH | CEL3 | physical | 20706207 | |
| IMPA1_ARATH | IMPA-1 | physical | 20706207 | |
| FBL17_ARATH | FBL17 | physical | 18948957 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
