| UniProt ID | CDKE1_ARATH | |
|---|---|---|
| UniProt AC | Q84TI6 | |
| Protein Name | Cyclin-dependent kinase E-1 | |
| Gene Name | CDKE-1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 470 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Involved in cell differentiation. Required for the specification of stamen and carpel identities and for the proper termination of stem cells in the floral meristem.. | |
| Protein Sequence | MGDGSSSRSNSSNSTSEKPEWLQQYNLVGKIGEGTYGLVFLARTKTPPKRPIAIKKFKQSKDGDGVSPTAIREIMLLREISHENVVKLVNVHINFADMSLYLAFDYAEYDLYEIIRHHRDKVGHSLNTYTVKSLLWQLLNGLNYLHSNWIIHRDLKPSNILVMGDAEEHGIVKIADFGLARIYQAPLKPLSDNGVVVTIWYRAPELLLGSKHYTSAVDMWAVGCIFAELLTLKPLFQGAEAKSSQNPFQLDQLDKIFKILGHPTMDKWPTLVNLPHWQNDVQHIQAHKYDSVGLHNVVHLNQKSPAYDLLSKMLEYDPLKRITASQALEHEYFRMDPLPGRNAFVASQPMEKNVNYPTRPVDTNTDFEGTTSINPPQAVAAGNVAGNMAGAHGMGSRSMPRPMVAHNMQRMQQSQGMMAYNFPAQAGLNPSVPLQQQRGMAQPHQQQQLRRKDPGMGMSGYAPPNKSRRL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 36 | Phosphorylation | GKIGEGTYGLVFLAR EEECCCCCEEEEEEE | 21.22 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDKE1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDKE1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDKE1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CCA21_ARATH | CYCA2;1 | physical | 20407024 | |
| CCA22_ARATH | CYC3B | physical | 20407024 | |
| CCA23_ARATH | CYCA2;3 | physical | 20407024 | |
| CCA34_ARATH | CYCA3;4 | physical | 20407024 | |
| CCD11_ARATH | CYCD1;1 | physical | 20407024 | |
| CCD31_ARATH | CYCD3;1 | physical | 20407024 | |
| CCD33_ARATH | CYCD3;3 | physical | 20407024 | |
| CCD41_ARATH | CYCD4;1 | physical | 20407024 | |
| CCD42_ARATH | CYCD4;2 | physical | 20407024 | |
| CCD51_ARATH | CYCD5;1 | physical | 20407024 | |
| CCH11_ARATH | CYCH;1 | physical | 20407024 | |
| KRP2_ARATH | KRP2 | physical | 20407024 | |
| KRP3_ARATH | ICK6 | physical | 20407024 | |
| KRP6_ARATH | KRP6 | physical | 20407024 | |
| CCC12_ARATH | AT5G48630 | physical | 21257604 | |
| CDKE1_ARATH | CDKE;1 | physical | 25281690 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
