dbPTM

SFH12_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SFH12_ARATH
UniProt AC	Q94A34
Protein Name	Phosphatidylinositol/phosphatidylcholine transfer protein SFH12
Gene Name	SFH12
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	543
Subcellular Localization	Golgi apparatus membrane Peripheral membrane protein. Cell membrane Peripheral membrane protein.
Protein Description	Required for transport of secretory proteins from the Golgi complex (By similarity). Catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes in vitro..
Protein Sequence	MTLIQDAELKPRMGSFKKRSSSKNLRYSMTKRRRSSKVMSVEIIEDVHDAEELKAVDAFRQSLILDELLPEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLRWRKEFGADTVMEEFDFKEIDEVLKYYPQGHHGVDKEGRPVYIERLGLVDSTKLMQVTTMDRYVNYHVMEFERTFNVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDESELPEFLGGSCTCADNGGCMRSDKGPWKNPEIMKRVHNGDHKCSKGSQAENSGEKTIPEEDDSTTEPASEEEKASKEVEIVPAAHPAWNMPEAHKFSLSKKEVYAIQEACNNATTEGGRSPIFTGVMALVMGVVTMIKVTKNVPRKLTESTLYSSPVYCDDASMNKSAMQSEKMTVPAISGEDFMAIMKRMAELEQKVTVLSAQPTVMPPDKEEMLNAAISRSNVLEQELAATKKALDDSLGRQEELVAYIEKKKKKKKLFNYW

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SFH12_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SFH12_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SFH12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SFH12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SFH12_ARATH

Related Literatures of Post-Translational Modification