| UniProt ID | BAS1A_ARATH | |
|---|---|---|
| UniProt AC | Q96291 | |
| Protein Name | 2-Cys peroxiredoxin BAS1, chloroplastic | |
| Gene Name | BAS1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 266 | |
| Subcellular Localization | Plastid, chloroplast . | |
| Protein Description | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf.. | |
| Protein Sequence | MASVASSTTLISSPSSRVFPAKSSLSSPSVSFLRTLSSPSASASLRSGFARRSSLSSTSRRSFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 98 | Phosphorylation | EFIKVKLSDYIGKKY HHHHHHHHHHCCCEE | 23.73 | 25561503 | |
| 161 | Phosphorylation | WVQTDRKSGGLGDLN HHCCCCCCCCCCCCC | 38.70 | 30291188 | |
| 209 | Phosphorylation | KEGVIQHSTINNLGI CCCEEECCCCCCCCC | 18.01 | 19880383 | |
| 210 | Phosphorylation | EGVIQHSTINNLGIG CCEEECCCCCCCCCC | 26.12 | 19880383 | |
| 252 | Sulfoxidation | WKPGEKSMKPDPKLS CCCCCCCCCCCCCCC | 12.37 | 25693801 | |
| 259 | Phosphorylation | MKPDPKLSKEYFSAI CCCCCCCCHHHHHCC | 29.57 | 25561503 | |
| 264 | Phosphorylation | KLSKEYFSAI----- CCCHHHHHCC----- | 24.93 | 29654922 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BAS1A_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BAS1A_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BAS1A_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BAS1B_ARATH | 2-Cys Prx B | physical | 21798944 | |
| BAS1A_ARATH | AT3G11630 | physical | 20615439 | |
| TRXB3_ARATH | NTRC | physical | 16884685 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
