| UniProt ID | BAS1B_ARATH | |
|---|---|---|
| UniProt AC | Q9C5R8 | |
| Protein Name | 2-Cys peroxiredoxin BAS1-like, chloroplastic | |
| Gene Name | At5g06290 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 273 | |
| Subcellular Localization | Plastid, chloroplast . | |
| Protein Description | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf.. | |
| Protein Sequence | MSMASIASSSSTTLLSSSRVLLPSKSSLLSPTVSFPRIIPSSSASSSSLCSGFSSLGSLTTNRSASRRNFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MSMASIASSSST ---CCHHHHHCCCCC | 15.28 | 24924143 | |
| 8 | Phosphorylation | MSMASIASSSSTTLL CCHHHHHCCCCCEEE | 29.14 | 24924143 | |
| 9 | Phosphorylation | SMASIASSSSTTLLS CHHHHHCCCCCEEEC | 21.20 | 24924143 | |
| 168 | Phosphorylation | WVQTDRKSGGLGDLN HHCCCCCCCCCCCCC | 38.70 | 30291188 | |
| 216 | Phosphorylation | KEGVIQHSTINNLGI CCCEEECCCCCCCCC | 18.01 | 19880383 | |
| 217 | Phosphorylation | EGVIQHSTINNLGIG CCEEECCCCCCCCCC | 26.12 | 19880383 | |
| 266 | Phosphorylation | MKPDPKLSKEYFSAI CCCCCCCCHHHHHCC | 29.57 | 25561503 | |
| 271 | Phosphorylation | KLSKEYFSAI----- CCCHHHHHCC----- | 24.93 | 29654922 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BAS1B_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BAS1B_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BAS1B_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of BAS1B_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
