UniProt ID | RBG2_ARATH | |
---|---|---|
UniProt AC | Q9SVM8 | |
Protein Name | Glycine-rich RNA-binding protein 2, mitochondrial | |
Gene Name | RBG2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 158 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Plays a role in RNA transcription or processing during stress. Binds RNAs and DNAs sequence with a preference to single-stranded nucleic acids. Displays strong affinity to poly(U) sequence. Exerts cold and freezing tolerance, probably by exhibiting an RNA chaperone activity during the cold and freezing adaptation process.. | |
Protein Sequence | MAFCNKLGGLLRQNISSNGNVPVTSMLGSLRLMSTKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPANDRPSAPRAYGGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGGF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
43 | Phosphorylation | KLFIGGLSWGTDDAS EEEECCCCCCCCCHH | - | ||
72 | Phosphorylation | KVIVDRETGRSRGFG EEEEECCCCCCCCEE | 23820729 | ||
75 | Phosphorylation | VDRETGRSRGFGFVN EECCCCCCCCEEEEE | 19880383 | ||
96 | Sulfoxidation | ATAAISEMDGKELNG CEEEEEECCCCEECC | 23289948 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RBG2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RBG2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RBG2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RBG2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...