| UniProt ID | NDK1_ARATH | |
|---|---|---|
| UniProt AC | P39207 | |
| Protein Name | Nucleoside diphosphate kinase 1 | |
| Gene Name | NDK1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 149 | |
| Subcellular Localization | Peroxisome . Nucleus . Cytoplasm . | |
| Protein Description | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress.. | |
| Protein Sequence | MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEQTFIMI -------CCCEEEEE | 8.53 | 22223895 | |
| 54 | Phosphorylation | KHYEDLSSKSFFSGL HHHHHHCCCCHHHHH | 39.35 | 25561503 | |
| 67 | Phosphorylation | GLVDYIVSGPVVAMI HHCHHHHHCCEEEEE | 28.02 | 19880383 | |
| 91 | Phosphorylation | GRKIIGATNPAASEP CCCEECCCCCCCCCC | 36.20 | 30291188 | |
| 117 | Phosphorylation | GRNVIHGSDSVESAR CCCEECCCCCHHHHH | 16.73 | 30291188 | |
| 119 | Phosphorylation | NVIHGSDSVESARKE CEECCCCCHHHHHHH | 29.49 | 30291188 | |
| 122 | Phosphorylation | HGSDSVESARKEIAL CCCCCHHHHHHHEEE | 31.08 | 23111157 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDK1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDK1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDK1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CATA1_ARATH | CAT1 | physical | 14581623 | |
| CATA2_ARATH | CAT2 | physical | 14581623 | |
| CATA3_ARATH | CAT3 | physical | 14581623 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
