| UniProt ID | AKRCB_ARATH | |
|---|---|---|
| UniProt AC | Q9M338 | |
| Protein Name | Aldo-keto reductase family 4 member C11 | |
| Gene Name | AKR4C11 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 315 | |
| Subcellular Localization | ||
| Protein Description | Oxidoreductase that may act on a broad range of substrates such as ketosteroids, aldehydes, ketones and sugars.. | |
| Protein Sequence | MADEIGFFQLNTGAKIPSVGLGTWQAAPGVVGDAVAAAVKIGYQHIDCASRYGNEIEIGKVLKKLFDDGVVKREKLFITSKIWLTDLDPPDVQDALNRTLQDLQLDYVDLYLMHWPVRLKKGTVDFKPENIMPIDIPSTWKAMEALVDSGKARAIGVSNFSTKKLSDLVEAARVPPAVNQVECHPSWQQHKLHEFCKSKGIHLSGYSPLGSPGTTWVKADVLKSPVIEMIAKEIGKSPAQTALRWGLQMGHSILPKSTNEGRIRENFDVLGWSIPKEMFDKFSKIEQARLVQGTSFVHETLSPYKTLEELWDGEI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MADEIGFFQ ------CCCCCEEEE | 24.12 | 22223895 | |
| 79 | Phosphorylation | KREKLFITSKIWLTD CHHEEEEEEEEEECC | 19.34 | 23172892 | |
| 80 | Phosphorylation | REKLFITSKIWLTDL HHEEEEEEEEEECCC | 19.82 | 19880383 | |
| 283 | Phosphorylation | KEMFDKFSKIEQARL HHHHHHCHHHHHHHH | 38.16 | 24894044 | |
| 295 | Phosphorylation | ARLVQGTSFVHETLS HHHHCCCCCHHCCCC | 31.90 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AKRCB_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AKRCB_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AKRCB_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of AKRCB_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...