UniProt ID | AKRCB_ARATH | |
---|---|---|
UniProt AC | Q9M338 | |
Protein Name | Aldo-keto reductase family 4 member C11 | |
Gene Name | AKR4C11 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 315 | |
Subcellular Localization | ||
Protein Description | Oxidoreductase that may act on a broad range of substrates such as ketosteroids, aldehydes, ketones and sugars.. | |
Protein Sequence | MADEIGFFQLNTGAKIPSVGLGTWQAAPGVVGDAVAAAVKIGYQHIDCASRYGNEIEIGKVLKKLFDDGVVKREKLFITSKIWLTDLDPPDVQDALNRTLQDLQLDYVDLYLMHWPVRLKKGTVDFKPENIMPIDIPSTWKAMEALVDSGKARAIGVSNFSTKKLSDLVEAARVPPAVNQVECHPSWQQHKLHEFCKSKGIHLSGYSPLGSPGTTWVKADVLKSPVIEMIAKEIGKSPAQTALRWGLQMGHSILPKSTNEGRIRENFDVLGWSIPKEMFDKFSKIEQARLVQGTSFVHETLSPYKTLEELWDGEI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADEIGFFQ ------CCCCCEEEE | 24.12 | 22223895 | |
79 | Phosphorylation | KREKLFITSKIWLTD CHHEEEEEEEEEECC | 19.34 | 23172892 | |
80 | Phosphorylation | REKLFITSKIWLTDL HHEEEEEEEEEECCC | 19.82 | 19880383 | |
283 | Phosphorylation | KEMFDKFSKIEQARL HHHHHHCHHHHHHHH | 38.16 | 24894044 | |
295 | Phosphorylation | ARLVQGTSFVHETLS HHHHCCCCCHHCCCC | 31.90 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AKRCB_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AKRCB_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AKRCB_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AKRCB_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...