GLDH_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GLDH_ARATH
• UniProt AC: Q9SU56
• Protein Name: L-galactono-1,4-lactone dehydrogenase, mitochondrial
• Gene Name: GLDH
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 610
• Subcellular Localization: Mitochondrion membrane ; Single-pass membrane protein .
• Protein Description: Involved in the biosynthesis of ascorbic acid. Required for the accumulation of respiratory complex I. Uses L-galactono-1,4-lactone and L-gulono-1,4-lactone as substrates, but not D-galactono-1,4-lactone, D-gulono-1,4-lactone, L-mannono-1,4-lactone or D-galactonic acid. Also active with phenazine methosulfate and 1,4-benzoquinone as electron acceptors..
• Protein Sequence: MLRSLLLRRSVGHSLGTLSPSSSTIRSSFSPHRTLCTTGQTLTPPPPPPPRPPPPPPATASEAQFRKYAGYAALAIFSGVATYFSFPFPENAKHKKAQIFRYAPLPEDLHTVSNWSGTHEVQTRNFNQPENLADLEALVKESHEKKLRIRPVGSGLSPNGIGLSRSGMVNLALMDKVLEVDKEKKRVTVQAGIRVQQLVDAIKDYGLTLQNFASIREQQIGGIIQVGAHGTGARLPPIDEQVISMKLVTPAKGTIELSREKDPELFHLARCGLGGLGVVAEVTLQCVARHELVEHTYVSNLQEIKKNHKKLLSANKHVKYLYIPYTDTVVVVTCNPVSKWSGPPKDKPKYTTDEAVQHVRDLYRESIVKYRVQDSGKKSPDSSEPDIQELSFTELRDKLLALDPLNDVHVAKVNQAEAEFWKKSEGYRVGWSDEILGFDCGGQQWVSESCFPAGTLANPSMKDLEYIEELKKLIEKEAIPAPAPIEQRWTARSKSPISPAFSTSEDDIFSWVGIIMYLPTADPRQRKDITDEFFHYRHLTQKQLWDQFSAYEHWAKIEIPKDKEELEALQARIRKRFPVDAYNKARRELDPNRILSNNMVEKLFPVSTTA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
440	Glutathionylation	DEILGFDCGGQQWVS CEEEEEECCCCCEEC	6.52	22833525
561	Acetylation	WAKIEIPKDKEELEA HHHCCCCCCHHHHHH	83.52	24727099
563	Acetylation	KIEIPKDKEELEALQ HCCCCCCHHHHHHHH	60.25	24727099
602	Acetylation	LSNNMVEKLFPVSTT CCCCHHHHHCCCCCC	43.98	24727099

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GLDH_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GLDH_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GLDH_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of GLDH_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.