14336_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: 14336_ARATH
• UniProt AC: P48349
• Protein Name: 14-3-3-like protein GF14 lambda
• Gene Name: GRF6
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 248
• Subcellular Localization: Nucleus . Cell membrane . Cytoplasm . Translocates from the cytosol to the nucleus when phosphorylated by CRPK1 in response to cold stress.
• Protein Description: Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes (By similarity). Specific negative regulator of slow-vacuolar (SV) ion channel. Mediates F-actin dynamics possibly through inhibiting ADF1 phosphorylation. [PubMed: 26345162 Negative regulator of freezing tolerance that modulates cold-responsive C-repeat-binding factors (CBF) DREB1A AND DREB1B proteins stability by facilitating their ubiquitin-mediated degradation when activated by CRPK1-mediated phosophorylation in freezing conditions]
• Protein Sequence: MAATLGRDQYVYMAKLAEQAERYEEMVQFMEQLVTGATPAEELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNDEHVSLVKDYRSKVESELSSVCSGILKLLDSHLIPSAGASESKVFYLKMKGDYHRYMAEFKSGDERKTAAEDTMLAYKAAQDIAAADMAPTHPIRLGLALNFSVFYYEILNSSDKACNMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEQMDEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
52	Phosphorylation	VEERNLLSVAYKNVI HHHHHHHHHHHHHHH	14.10	25561503
70	Phosphorylation	RAAWRIVSSIEQKEE HHHHHHHHHHHHHHH	24.19	28344081
112	Phosphorylation	GILKLLDSHLIPSAG HHHHHHHHCCCCCCC	21.84	22092075
193	Phosphorylation	FYYEILNSSDKACNM HHHHHHCCCHHHHHH	36.15	28344081
214	Phosphorylation	EAIAELDTLGEESYK HHHHHHHCCCCHHHC	49.65	23328941

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
70	S	Phosphorylation	Kinase	CRPK1	Q93YN1	Uniprot
112	S	Phosphorylation	Kinase	CRPK1	Q93YN1	Uniprot
193	S	Phosphorylation	Kinase	CRPK1	Q93YN1	Uniprot
214	T	Phosphorylation	Kinase	CRPK1	Q93YN1	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of 14336_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of 14336_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SERK1_ARATH	SERK1	physical	15592873
CD48A_ARATH	CDC48	physical	15592873
BZR1_ARATH	BZR1	physical	17681130
BZR2_ARATH	BES1	physical	17681130
OMT1_ARATH	OMT1	physical	9349713
APX3_ARATH	APX3	physical	9290648
FB316_ARATH	AT1G61340	physical	22920997
KCO1_ARATH	ATKCO1	physical	25189593
14333_ARATH	GRF3	physical	10622729
14336_ARATH	GRF6	physical	10622729
ADF1_ARATH	ADF1	physical	26345162
ADF1_ARATH	ADF1	genetic	26345162

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.