UniProt ID | 14336_ARATH | |
---|---|---|
UniProt AC | P48349 | |
Protein Name | 14-3-3-like protein GF14 lambda | |
Gene Name | GRF6 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 248 | |
Subcellular Localization | Nucleus . Cell membrane . Cytoplasm . Translocates from the cytosol to the nucleus when phosphorylated by CRPK1 in response to cold stress. | |
Protein Description | Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes (By similarity). Specific negative regulator of slow-vacuolar (SV) ion channel. Mediates F-actin dynamics possibly through inhibiting ADF1 phosphorylation. [PubMed: 26345162 Negative regulator of freezing tolerance that modulates cold-responsive C-repeat-binding factors (CBF) DREB1A AND DREB1B proteins stability by facilitating their ubiquitin-mediated degradation when activated by CRPK1-mediated phosophorylation in freezing conditions] | |
Protein Sequence | MAATLGRDQYVYMAKLAEQAERYEEMVQFMEQLVTGATPAEELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNDEHVSLVKDYRSKVESELSSVCSGILKLLDSHLIPSAGASESKVFYLKMKGDYHRYMAEFKSGDERKTAAEDTMLAYKAAQDIAAADMAPTHPIRLGLALNFSVFYYEILNSSDKACNMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEQMDEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Phosphorylation | VEERNLLSVAYKNVI HHHHHHHHHHHHHHH | 14.10 | 25561503 | |
70 | Phosphorylation | RAAWRIVSSIEQKEE HHHHHHHHHHHHHHH | 24.19 | 28344081 | |
112 | Phosphorylation | GILKLLDSHLIPSAG HHHHHHHHCCCCCCC | 21.84 | 22092075 | |
193 | Phosphorylation | FYYEILNSSDKACNM HHHHHHCCCHHHHHH | 36.15 | 28344081 | |
214 | Phosphorylation | EAIAELDTLGEESYK HHHHHHHCCCCHHHC | 49.65 | 23328941 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
70 | S | Phosphorylation | Kinase | CRPK1 | Q93YN1 | Uniprot |
112 | S | Phosphorylation | Kinase | CRPK1 | Q93YN1 | Uniprot |
193 | S | Phosphorylation | Kinase | CRPK1 | Q93YN1 | Uniprot |
214 | T | Phosphorylation | Kinase | CRPK1 | Q93YN1 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 14336_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 14336_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SERK1_ARATH | SERK1 | physical | 15592873 | |
CD48A_ARATH | CDC48 | physical | 15592873 | |
BZR1_ARATH | BZR1 | physical | 17681130 | |
BZR2_ARATH | BES1 | physical | 17681130 | |
OMT1_ARATH | OMT1 | physical | 9349713 | |
APX3_ARATH | APX3 | physical | 9290648 | |
FB316_ARATH | AT1G61340 | physical | 22920997 | |
KCO1_ARATH | ATKCO1 | physical | 25189593 | |
14333_ARATH | GRF3 | physical | 10622729 | |
14336_ARATH | GRF6 | physical | 10622729 | |
ADF1_ARATH | ADF1 | physical | 26345162 | |
ADF1_ARATH | ADF1 | genetic | 26345162 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...