APX3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APX3_ARATH
• UniProt AC: Q42564
• Protein Name: L-ascorbate peroxidase 3
• Gene Name: APX3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 287
• Subcellular Localization: Peroxisome membrane ; Single-pass membrane protein . Glyoxysome membrane ; Single-pass membrane protein .
• Protein Description: Plays a key role in hydrogen peroxide removal..
• Protein Sequence: MAAPIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEHTHGANSGLKIALDLCEGVKAKHPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDSNVCPKEGRLPDAKQGFQHLRDVFYRMGLSDKDIVALSGGHTLGRAHPERSGFDGPWTQEPLKFDNSYFVELLKGESEGLLKLPTDKTLLEDPEFRRLVELYAKDEDAFFRDYAESHKKLSELGFNPNSSAGKAVADSTILAQSAFGVAVAAAVVAFGYFYEIRKRMK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAPIVDAE ------CCCCCCCHH	23.19	22223895

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APX3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APX3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APX3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AKR2A_ARATH	AKR2	physical	11862948

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.