ADF1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ADF1_ARATH
• UniProt AC: Q39250
• Protein Name: Actin-depolymerizing factor 1
• Gene Name: ADF1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 139
• Subcellular Localization: Cytoplasm, cytoskeleton .
• Protein Description: Actin-depolymerizing protein. Stimulates F-actin depolymerization. Involved in plant development, cell organ expansion and flowering by controlling breakdown of thick actin cables. [PubMed: 11402164 Severs actin filaments or bundles and promotes actin cytoskeleton disassembly]
• Protein Sequence: MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQPIQTYEEFAACLPADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVELQATDPTEMDLDVFRSRAN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MANAASGMAVHDD --CCCCCCCCCCCCC	27.04	14593172

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
6	S	Phosphorylation	Kinase	CPK3	Q42479	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
6	S	Phosphorylation	Phosphorylation at Ser-6 by CPK3/CDPK6 inhibits actin-depolimerizing activity.	23903947

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ADF1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ADF1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.