dbPTM

TLP10_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TLP10_ARATH
UniProt AC	Q9FRH7
Protein Name	Tubby-like F-box protein 10
Gene Name	TULP10
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	445
Subcellular Localization	Nucleus.
Protein Description	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins..
Protein Sequence	MSFRGIVQDLRDGFGSLSRRSFDFRLSSLHKGKAQGSSFREYSSSRDLLSPVIVQTSRWANLPPELLFDVIKRLEESESNWPARKHVVACASVCRSWRAMCQEIVLGPEICGKLTFPVSLKQPGPRDAMIQCFIKRDKSKLTFHLFLCLSPALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDRTSRSRFHSRRVSPKVPSGSYNIAQITYELNVLGTRGPRRMHCIMNSIPISSLEPGGSVPNQPEKLVPAPYSLDDSFRSNISFSKSSFDHRSLDFSSSRFSEMGISCDDNEEEASFRPLILKNKQPRWHEQLQCWCLNFRGRVTVASVKNFQLVAARQPQPQGTGAAAAPTSAPAHPEQDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Phosphorylation	HKGKAQGSSFREYSS HCCCCCCCCHHCCCC	17.77	29654922
50	Phosphorylation	SSSRDLLSPVIVQTS CCCCHHCCCEEEECC	25.15	30291188
57	Phosphorylation	SPVIVQTSRWANLPP CCEEEECCCHHCCCH	14.56	25561503
299	Phosphorylation	APYSLDDSFRSNISF CCCCCCHHHHCCCCC	23.40	30407730
319	Phosphorylation	DHRSLDFSSSRFSEM CCCCCCCCCCHHHHC	27.37	25561503
320	Phosphorylation	HRSLDFSSSRFSEMG CCCCCCCCCHHHHCC	26.06	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TLP10_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TLP10_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TLP10_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SKP1A_ARATH	SKP1	physical	23166809
SKP1B_ARATH	ASK2	physical	23166809
SKP1A_ARATH	SKP1	physical	25168737
SKP1B_ARATH	ASK2	physical	25168737

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TLP10_ARATH

Related Literatures of Post-Translational Modification