UniProt ID | TLP10_ARATH | |
---|---|---|
UniProt AC | Q9FRH7 | |
Protein Name | Tubby-like F-box protein 10 | |
Gene Name | TULP10 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 445 | |
Subcellular Localization | Nucleus. | |
Protein Description | Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.. | |
Protein Sequence | MSFRGIVQDLRDGFGSLSRRSFDFRLSSLHKGKAQGSSFREYSSSRDLLSPVIVQTSRWANLPPELLFDVIKRLEESESNWPARKHVVACASVCRSWRAMCQEIVLGPEICGKLTFPVSLKQPGPRDAMIQCFIKRDKSKLTFHLFLCLSPALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDRTSRSRFHSRRVSPKVPSGSYNIAQITYELNVLGTRGPRRMHCIMNSIPISSLEPGGSVPNQPEKLVPAPYSLDDSFRSNISFSKSSFDHRSLDFSSSRFSEMGISCDDNEEEASFRPLILKNKQPRWHEQLQCWCLNFRGRVTVASVKNFQLVAARQPQPQGTGAAAAPTSAPAHPEQDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Phosphorylation | HKGKAQGSSFREYSS HCCCCCCCCHHCCCC | 17.77 | 29654922 | |
50 | Phosphorylation | SSSRDLLSPVIVQTS CCCCHHCCCEEEECC | 25.15 | 30291188 | |
57 | Phosphorylation | SPVIVQTSRWANLPP CCEEEECCCHHCCCH | 14.56 | 25561503 | |
299 | Phosphorylation | APYSLDDSFRSNISF CCCCCCHHHHCCCCC | 23.40 | 30407730 | |
319 | Phosphorylation | DHRSLDFSSSRFSEM CCCCCCCCCCHHHHC | 27.37 | 25561503 | |
320 | Phosphorylation | HRSLDFSSSRFSEMG CCCCCCCCCHHHHCC | 26.06 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TLP10_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TLP10_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TLP10_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SKP1A_ARATH | SKP1 | physical | 23166809 | |
SKP1B_ARATH | ASK2 | physical | 23166809 | |
SKP1A_ARATH | SKP1 | physical | 25168737 | |
SKP1B_ARATH | ASK2 | physical | 25168737 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...