IBR5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IBR5_ARATH
• UniProt AC: Q84JU4
• Protein Name: Protein-tyrosine-phosphatase IBR5
• Gene Name: IBR5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 257
• Subcellular Localization: Nucleus .
• Protein Description: Required for the transduction of auxin and abscisic acid (ABA) signaling pathways. Dephosphorylates and inactivates the MAP kinase MPK12..
• Protein Sequence: MRKRERENPCSICGHYHKYEEGEVCGVCGHCMPVSSDTVAPQQVHVSAFPSEILPEFLYLGSYDNASRSELLKTQGISRVLNTVPMCQNLYRNSFTYHGLDNEKVLQFDDAIKFLDQCEKDKARVLVHCMSGKSRSPAVVVAYLMKRKGWRLAESHQWVKQRRPSTDISPEFYQQLQEFEQGIFGSEMMSAMNINDAPTFGFGFPKIDNQAQAPVFNNAPTSSIFSSPASSIPPQEFTFGATPPKPTTGGDIAMDGS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
94	Phosphorylation	CQNLYRNSFTYHGLD HHHHHCCCCEECCCC	15.23	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IBR5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IBR5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IBR5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MPK12_ARATH	MPK12	physical	19000167

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.