UniProt ID | IBR5_ARATH | |
---|---|---|
UniProt AC | Q84JU4 | |
Protein Name | Protein-tyrosine-phosphatase IBR5 | |
Gene Name | IBR5 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 257 | |
Subcellular Localization | Nucleus . | |
Protein Description | Required for the transduction of auxin and abscisic acid (ABA) signaling pathways. Dephosphorylates and inactivates the MAP kinase MPK12.. | |
Protein Sequence | MRKRERENPCSICGHYHKYEEGEVCGVCGHCMPVSSDTVAPQQVHVSAFPSEILPEFLYLGSYDNASRSELLKTQGISRVLNTVPMCQNLYRNSFTYHGLDNEKVLQFDDAIKFLDQCEKDKARVLVHCMSGKSRSPAVVVAYLMKRKGWRLAESHQWVKQRRPSTDISPEFYQQLQEFEQGIFGSEMMSAMNINDAPTFGFGFPKIDNQAQAPVFNNAPTSSIFSSPASSIPPQEFTFGATPPKPTTGGDIAMDGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
94 | Phosphorylation | CQNLYRNSFTYHGLD HHHHHCCCCEECCCC | 15.23 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IBR5_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IBR5_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IBR5_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MPK12_ARATH | MPK12 | physical | 19000167 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...