UniProt ID | MPK12_ARATH | |
---|---|---|
UniProt AC | Q8GYQ5 | |
Protein Name | Mitogen-activated protein kinase 12 | |
Gene Name | MPK12 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 372 | |
Subcellular Localization | Nucleus . | |
Protein Description | Negative regulator of the auxin transduction signaling pathway.. | |
Protein Sequence | MSGESSSGSTEHCIKVVPTHGGRYVQYNVYGQLFEVSRKYVPPIRPIGRGACGIVCAAVNSVTGEKVAIKKIGNAFDNIIDAKRTLREIKLLRHMDHENVITIKDIVRPPQRDIFNDVYIVYELMDTDLQRILRSNQTLTSDQCRFLVYQLLRGLKYVHSANILHRDLRPSNVLLNSKNELKIGDFGLARTTSDTDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTGQPLFPGKDYVHQLRLITELVGSPDNSSLGFLRSDNARRYVRQLPRYPKQQFAARFPKMPTTAIDLLERMLVFDPNRRISVDEALGHAYLSPHHDVAKEPVCSTPFSFDFEHPSCTEEHIKELIYKESVKFNPDH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
199 | Phosphorylation | TSDTDFMTEYVVTRW CCCCCHHHHHHHHHH | 24.94 | - | |
201 | Phosphorylation | DTDFMTEYVVTRWYR CCCHHHHHHHHHHCC | 7.34 | - | |
204 | Phosphorylation | FMTEYVVTRWYRAPE HHHHHHHHHHCCCHH | 12.87 | 24243849 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPK12_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
199 | T | Phosphorylation |
| 27923039 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPK12_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MPK12_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...